Recombinant Full Length Mouse 2-Oxoglutarate Receptor 1(Oxgr1) Protein, His-Tagged
Cat.No. : | RFL14161MF |
Product Overview : | Recombinant Full Length Mouse 2-oxoglutarate receptor 1(Oxgr1) Protein (Q6IYF8) (1-337aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mus musculus |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length (1-337) |
Form : | Lyophilized powder |
AA Sequence : | MIEPLDSPASDSDFLDYPSALGNCTDEQISFKMQYLPVIYSIIFLVGFPGNTVAISIYIF KMRPWRGSTVIMLNLALTDLLYLTSLPFLIHYYASGENWIFGDFMCKFIRFGFHFNLYSS ILFLTCFSLFRYVVIIHPMSCFSIQKTRWAVVACAGVWVISLVAVMPMTFLITSTTRTNR SACLDLTSSDDLTTIKWYNLILTATTFCLPLVIVTLCYTTIISTLTHGPRTHSCFKQKAR RLTILLLLVFYICFLPFHILRVIRIESRLLSISCSIESHIHEAYIVSRPLAALNTFGNLL LYVVVSNNFQQAFCSIVRCKASGDLEQGKKDSCSNNP |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | Oxgr1 |
Synonyms | Oxgr1; Gpr99; 2-oxoglutarate receptor 1; Alpha-ketoglutarate receptor 1; G-protein coupled receptor 99 |
UniProt ID | Q6IYF8 |
◆ Recombinant Proteins | ||
RFL33645HF | Recombinant Full Length Human 2-Oxoglutarate Receptor 1(Oxgr1) Protein, His-Tagged | +Inquiry |
OXGR1-3885R | Recombinant Rat OXGR1 Protein, His (Fc)-Avi-tagged | +Inquiry |
RFL28797RF | Recombinant Full Length Rat 2-Oxoglutarate Receptor 1(Oxgr1) Protein, His-Tagged | +Inquiry |
OXGR1-4223R | Recombinant Rat OXGR1 Protein | +Inquiry |
OXGR1-12258M | Recombinant Mouse OXGR1 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
OXGR1-3506HCL | Recombinant Human OXGR1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Oxgr1 Products
Required fields are marked with *
My Review for All Oxgr1 Products
Required fields are marked with *
0
Inquiry Basket