Recombinant Full Length Mouse 5-Hydroxytryptamine Receptor 2A(Htr2A) Protein, His-Tagged
Cat.No. : | RFL31788MF |
Product Overview : | Recombinant Full Length Mouse 5-hydroxytryptamine receptor 2A(Htr2a) Protein (P35363) (1-471aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mus musculus |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length (1-471) |
Form : | Lyophilized powder |
AA Sequence : | MEILCEDNISLSSIPNSLMQLGDDSRLYPNDFNSRDANTSEASNWTIDAENRTNLSCEGY LPPTCLSILHLQEKNWSALLTTVVIILTIAGNILVIMAVSLEKKLQNATNYFLMSLAIAD MLLGFLVMPVSMLTILYGYRWPLPSKLCAVWIYLDVLFSTASIMHLCAISLDRYVAIQNP IHHSRFNSRTKAFLKIIAVWTISVGISMPIPVFGLQDDSKVFKEGSCLLADDNFVLIGSF VAFFIPLTIMVITYFLTIKSLQKEATLCVSDLSTRAKLSSFSFLPQSSLSSEKLFQRSIH REPGSYAGRRTMQSISNEQKACKVLGIVFFLFVVMWCPFFITNIMAVICKESCNENVIGA LLNVFVWIGYLSSAVNPLVYTLFNKTYRSAFSRYIQCQYKENRKPLQLILVNTIPTLAYK SSQLQVGQKKNSQEDAEPTANDCSMVTLGNQHSEEMCTDNIETVNEKVSCV |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | Htr2a |
Synonyms | Htr2a; Htr2; 5-hydroxytryptamine receptor 2A; 5-HT-2; 5-HT-2A; Serotonin receptor 2A |
UniProt ID | P35363 |
◆ Recombinant Proteins | ||
HTR2A-1561H | Recombinant Human HTR2A, His-tagged | +Inquiry |
RFL35893PF | Recombinant Full Length Pongo Pygmaeus 5-Hydroxytryptamine Receptor 2A(Htr2A) Protein, His-Tagged | +Inquiry |
HTR2A-1090HFL | Recombinant Human HTR2A protein, His&Flag-tagged | +Inquiry |
HTR2A-2175R | Recombinant Rhesus monkey HTR2A Protein, His-tagged | +Inquiry |
HTR2A-2962R | Recombinant Rat HTR2A Protein | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Htr2a Products
Required fields are marked with *
My Review for All Htr2a Products
Required fields are marked with *
0
Inquiry Basket