Recombinant Full Length Mouse Cd27 Antigen(Cd27) Protein, His-Tagged
Cat.No. : | RFL20496MF |
Product Overview : | Recombinant Full Length Mouse CD27 antigen(Cd27) Protein (P41272) (24-250aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mus musculus |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length of Mature Protein (24-250) |
Form : | Lyophilized powder |
AA Sequence : | PNSCPDKHYWTGGGLCCRMCEPGTFFVKDCEQDRTAAQCDPCIPGTSFSPDYHTRPHCESCRHCNSGFLIRNCTVTANAECSCSKNWQCRDQECTECDPPLNPALTRQPSETPSPQPPPTHLPHGTEKPSWPLHRQLPNSTVYSQRSSHRPLCSSDCIRIFVTFSSMFLIFVLGAILFFHQRRNHGPNEDRQAVPEEPCPYSCPREEEGSAIPIQEDYRKPEPAFYP |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | Cd27 |
Synonyms | Cd27; Tnfrsf7; CD27 antigen; CD27L receptor; T-cell activation antigen CD27; Tumor necrosis factor receptor superfamily member 7; CD antigen CD27 |
UniProt ID | P41272 |
◆ Recombinant Proteins | ||
CD27-7139H | Recombinant Human CD27 Molecule, His-tagged | +Inquiry |
Cd27-840MAF555 | Active Recombinant Mouse Cd27 Protein, His/Fc-tagged, Alexa Fluor 555 conjugated | +Inquiry |
CD27-1079H | Recombinant Human CD27 protein, hFc-tagged | +Inquiry |
CD27-152H | Recombinant Human CD27 Protein, His-tagged | +Inquiry |
Cd27-643G | Recombinant Golden hamster Cd27 protein, His&Strep II-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CD27-1156CCL | Recombinant Cynomolgus CD27 cell lysate | +Inquiry |
CD27-2415MCL | Recombinant Mouse CD27 cell lysate | +Inquiry |
CD27-001HCL | Recombinant Human CD27 cell lysate | +Inquiry |
CD27-1383HCL | Recombinant Human CD27 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Cd27 Products
Required fields are marked with *
My Review for All Cd27 Products
Required fields are marked with *
0
Inquiry Basket