Recombinant Full Length Mouse Cd27 Antigen(Cd27) Protein, His-Tagged
| Cat.No. : | RFL20496MF |
| Product Overview : | Recombinant Full Length Mouse CD27 antigen(Cd27) Protein (P41272) (24-250aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Mouse |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | Full Length of Mature Protein (24-250) |
| Form : | Lyophilized powder |
| AA Sequence : | PNSCPDKHYWTGGGLCCRMCEPGTFFVKDCEQDRTAAQCDPCIPGTSFSPDYHTRPHCESCRHCNSGFLIRNCTVTANAECSCSKNWQCRDQECTECDPPLNPALTRQPSETPSPQPPPTHLPHGTEKPSWPLHRQLPNSTVYSQRSSHRPLCSSDCIRIFVTFSSMFLIFVLGAILFFHQRRNHGPNEDRQAVPEEPCPYSCPREEEGSAIPIQEDYRKPEPAFYP |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Applications : | SDS-PAGE |
| Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
| Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
| Gene Name | Cd27 |
| Synonyms | Cd27; Tnfrsf7; CD27 antigen; CD27L receptor; T-cell activation antigen CD27; Tumor necrosis factor receptor superfamily member 7; CD antigen CD27 |
| UniProt ID | P41272 |
| ◆ Recombinant Proteins | ||
| CD27-638HAF555 | Recombinant Human CD27 Protein, Fc/His-tagged, Alexa Fluor 555 conjugated | +Inquiry |
| CD27-1079HA | Active Recombinant Human CD27 protein, Fc-tagged, APC-labeled | +Inquiry |
| CD27-638H | Recombinant Human CD27, Fc-His tagged | +Inquiry |
| CD27-180HAF647 | Active Recombinant Human CD27 Protein, Fc-tagged, Alexa Fluor 647 conjugated | +Inquiry |
| Cd27-840MF | Active Recombinant Mouse Cd27 Protein, His/Fc-tagged, FITC conjugated | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| CD27-1156CCL | Recombinant Cynomolgus CD27 cell lysate | +Inquiry |
| CD27-2415MCL | Recombinant Mouse CD27 cell lysate | +Inquiry |
| CD27-1383HCL | Recombinant Human CD27 cell lysate | +Inquiry |
| CD27-001HCL | Recombinant Human CD27 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Cd27 Products
Required fields are marked with *
My Review for All Cd27 Products
Required fields are marked with *



