Recombinant Full Length Mouse Derlin-3(Derl3) Protein, His-Tagged
| Cat.No. : | RFL25269MF |
| Product Overview : | Recombinant Full Length Mouse Derlin-3(Derl3) Protein (Q9D8K3) (1-228aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Mouse |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | Full Length (1-228) |
| Form : | Lyophilized powder |
| AA Sequence : | MAGQRLAAGFLQVPAVTRAYTAACVLTTAAVQLELLSPFQLYFNPHLVFRKFQVWRLITT FLFFGPLGFGFFFNMLFVFRYCRMLEEGSFRGRKADFVFMFLFGGVLMTLLGFLGSLFFL GQALMAMLVYVWSRRSPHVRVNFFGLLNFQAPFLPWALMGFSLLLGNSVVTDLLGILVGH IYYFLEDVFPNQPGGKRLLLTPSVLKLLLDDPQEDPDYLPLPEEQPEL |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
| Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
| Gene Name | Derl3 |
| Synonyms | Derl3; Der3; Izp6; Derlin-3; Degradation in endoplasmic reticulum protein 3; Der1-like protein 3; Protein IZP6 |
| UniProt ID | Q9D8K3 |
| ◆ Recombinant Proteins | ||
| DERL3-11146Z | Recombinant Zebrafish DERL3 | +Inquiry |
| DERL3-2475HF | Recombinant Full Length Human DERL3 Protein, GST-tagged | +Inquiry |
| RFL25602BF | Recombinant Full Length Bovine Derlin-3(Derl3) Protein, His-Tagged | +Inquiry |
| DERL3-2548H | Recombinant Human DERL3 Protein, GST-tagged | +Inquiry |
| RFL25269MF | Recombinant Full Length Mouse Derlin-3(Derl3) Protein, His-Tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| DERL3-224HCL | Recombinant Human DERL3 lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Derl3 Products
Required fields are marked with *
My Review for All Derl3 Products
Required fields are marked with *
