Recombinant Full Length Mouse Ephrin-B1(Efnb1) Protein, His-Tagged
Cat.No. : | RFL29358MF |
Product Overview : | Recombinant Full Length Mouse Ephrin-B1(Efnb1) Protein (P52795) (25-345aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mus musculus |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length of Mature Protein (25-345) |
Form : | Lyophilized powder |
AA Sequence : | ATPLAKNLEPVSWSSLNPKFLSGKGLVIYPKIGDKLDIICPRAEAGRPYEYYKLYLVRPEQAAACSTVLDPNVLVTCNKPHQEIRFTIKFQEFSPNYMGLEFKKYHDYYITSTSNGSLEGLENREGGVCRTRTMKIVMKVGQDPNAVTPEQLTTSRPSKESDNTVKTATQAPGRGSQGDSDGKHETVNQEEKSGPGAGGGGSGDSDSFFNSKVALFAAVGAGCVIFLLIIIFLTVLLLKLRKRHRKHTQQRAAALSLSTLASPKGGSGTAGTEPSDIIIPLRTTENNYCPHYEKVSGDYGHPVYIVQEMPPQSPANIYYKV |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | Efnb1 |
Synonyms | Efnb1; Epl2; Eplg2; Lerk2; Stra1; Ephrin-B1; CEK5 receptor ligand; CEK5-L; EFL-3; ELK ligand; ELK-L; EPH-related receptor tyrosine kinase ligand 2; LERK-2; Stimulated by retinoic acid gene 1 protein |
UniProt ID | P52795 |
◆ Recombinant Proteins | ||
EFNB1-001H | Recombinant Human EFNB1 Protein, hIgG-His-tagged | +Inquiry |
Efnb1-7434R | Active Recombinant Rat Efnb1 protein(Met1-Thr229), hFc-tagged | +Inquiry |
EFNB1-3102H | Recombinant Human EFNB1 Protein, GST-tagged | +Inquiry |
EFNB1-2237H | Recombinant Human EFNB1 protein, His-tagged | +Inquiry |
EFNB1-6592C | Recombinant Chicken EFNB1 | +Inquiry |
◆ Cell & Tissue Lysates | ||
EFNB1-2537HCL | Recombinant Human EFNB1 cell lysate | +Inquiry |
EFNB1-2152MCL | Recombinant Mouse EFNB1 cell lysate | +Inquiry |
EFNB1-1515RCL | Recombinant Rat EFNB1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Efnb1 Products
Required fields are marked with *
My Review for All Efnb1 Products
Required fields are marked with *
0
Inquiry Basket