Recombinant Full Length Mouse Fatty Acid 2-Hydroxylase(Fa2H) Protein, His-Tagged
Cat.No. : | RFL16637MF |
Product Overview : | Recombinant Full Length Mouse Fatty acid 2-hydroxylase(Fa2h) Protein (Q5MPP0) (1-372aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mus musculus |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length (1-372) |
Form : | Lyophilized powder |
AA Sequence : | MAPAPPPAASFTPAEVQRRLAAGACWVRRGASLYDLTSFVRHHPGGEQLLLARAGQDISA DLDGPPHRHSDNARRWLEQYYVGELRADPQDPTENGAVASAETQKTDPALEPQFKVVDWD KDLVDWQKPLLWQVGHLGEKYDEWVHQPVARPIRLFHSDLIEAFSKTVWYSVPIIWVPLV LYLSWSYYRTLTQDNIRLFASLTREYSMMMPESVFIGLFVLGMLFWTFVEYVIHRFLFHM KPPSNSHYLIMLHFVMHGQHHKAPFDGSRLVFPPVPASLVIAFFYVFLRLILPETVGGII FAGGLLGYVLYDMTHYYLHFGSPHKGSYLYNMKAHHVKHHFEYQKSGFGISTKLWDYFFH TLIPEEAHPKMQ |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | Fa2h |
Synonyms | Fa2h; Faah; Fatty acid 2-hydroxylase; Fatty acid alpha-hydroxylase |
UniProt ID | Q5MPP0 |
◆ Recombinant Proteins | ||
FA2H-1359R | Recombinant Rhesus Macaque FA2H Protein, His (Fc)-Avi-tagged | +Inquiry |
FA2H-2182R | Recombinant Rat FA2H Protein | +Inquiry |
FA2H-893H | Recombinant Human FA2H, GST-tagged | +Inquiry |
FA2H-12628H | Recombinant Human FA2H, His-tagged | +Inquiry |
Fa2h-2901M | Recombinant Mouse Fa2h Protein, Myc/DDK-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
FA2H-6481HCL | Recombinant Human FA2H 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Fa2h Products
Required fields are marked with *
My Review for All Fa2h Products
Required fields are marked with *
0
Inquiry Basket