Recombinant Full Length Mouse G-Protein Coupled Receptor Family C Group 5 Member C(Gprc5C) Protein, His-Tagged
Cat.No. : | RFL11974MF |
Product Overview : | Recombinant Full Length Mouse G-protein coupled receptor family C group 5 member C(Gprc5c) Protein (Q8K3J9) (23-440aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mus musculus |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length of Mature Protein (23-440) |
Form : | Lyophilized powder |
AA Sequence : | QNHAPPGCSPDLDPLYYNLCDRSGAWGIVSEAVAGAGIITTFVLTIILVASLPFVQDTKK RSLLGTQVFFLLGTLGLFCLVFACVVKPDFSTCASRRFLFGVLFAICFSCLVAHVLSLNF LTRKNHGPRGWVIFTVALLLTLVEVIINTEWLIITLVRGGGQVSPLGNVSADSTMTSPCA IANMDFVMALIYVMLLLLTAFLGAWPTLCGRFKRWRKHGVFVLLTTVISIAIWVVWIVMY TYGNEQHHSPTWDDPTLAIALAANAWTFVLFYVIPEVSQVTKPSPEQSYQGDMYPTRGVG YETILKEQTGQSMFVENKAFSMDEPASAKRPVSPYSGYNGQLLTSVYQPTEMALMHKGPS EGAYDVILPRATANSQVMGSANSTLRAEDMYMVQSHQVATPPKDGKISQVFRNPYVWD |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | Gprc5c |
Synonyms | Gprc5c; Raig3; G-protein coupled receptor family C group 5 member C; Retinoic acid-induced gene 3 protein; RAIG-3 |
UniProt ID | Q8K3J9 |
◆ Recombinant Proteins | ||
GPRC5C-6055Z | Recombinant Zebrafish GPRC5C | +Inquiry |
RFL11974MF | Recombinant Full Length Mouse G-Protein Coupled Receptor Family C Group 5 Member C(Gprc5C) Protein, His-Tagged | +Inquiry |
RFL30518HF | Recombinant Full Length Human G-Protein Coupled Receptor Family C Group 5 Member C(Gprc5C) Protein, His-Tagged | +Inquiry |
GPRC5C-5288H | Recombinant Human GPRC5C Protein | +Inquiry |
GPRC5C-3701H | Recombinant Human GPRC5C protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
GPRC5C-748HCL | Recombinant Human GPRC5C cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Gprc5c Products
Required fields are marked with *
My Review for All Gprc5c Products
Required fields are marked with *