Recombinant Full Length Mouse Glioma Pathogenesis-Related Protein 1(Glipr1) Protein, His-Tagged
| Cat.No. : | RFL19881MF |
| Product Overview : | Recombinant Full Length Mouse Glioma pathogenesis-related protein 1(Glipr1) Protein (Q9CWG1) (18-255aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Mouse |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | Full Length of Mature Protein (18-255) |
| Form : | Lyophilized powder |
| AA Sequence : | SSFTASTLPDITNEDFIKECVQVHNQLRSKVSPPARNMLYMSWDPKLAQIAKAWTKSCEF KHNPQLHSRIHPNFTALGENIWLGSLSIFSVSSAISAWYEEIKHYDFSTRKCRHVCGHYT QVVWADSYKLGCAVQLCPNGANFICDYGPAGNYPTWPYKQGATCSDCPKDDKCLNSLCIN PRRDQVSRYYSVDYPDWPIYLRNRYTSLFLIAKSVLLLLSVIITIWVKHKYPNLVLLD |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
| Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
| Gene Name | Glipr1 |
| Synonyms | Glipr1; Glioma pathogenesis-related protein 1; GliPR 1 |
| UniProt ID | Q9CWG1 |
| ◆ Recombinant Proteins | ||
| GLIPR1-3451H | Recombinant Human GLIPR1 Protein (Asn22-Arg232), C-His tagged | +Inquiry |
| GLIPR1-2966H | Recombinant Human GLIPR1 protein, His-tagged | +Inquiry |
| GLIPR1-1867R | Recombinant Rhesus monkey GLIPR1 Protein, His-tagged | +Inquiry |
| RFL19881MF | Recombinant Full Length Mouse Glioma Pathogenesis-Related Protein 1(Glipr1) Protein, His-Tagged | +Inquiry |
| GLIPR1-3190H | Recombinant Human GLIPR1 protein(Met1-Arg232), His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| GLIPR1-807MCL | Recombinant Mouse GLIPR1 cell lysate | +Inquiry |
| GLIPR1-2392HCL | Recombinant Human GLIPR1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Glipr1 Products
Required fields are marked with *
My Review for All Glipr1 Products
Required fields are marked with *



