Recombinant Human GLIPR1 protein, His-tagged
Cat.No. : | GLIPR1-2966H |
Product Overview : | Recombinant Human GLIPR1 protein(P48060)(22-232aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 22-232aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 28.1 kDa |
AA Sequence : | ANILPDIENEDFIKDCVRIHNKFRSEVKPTASDMLYMTWDPALAQIAKAWASNCQFSHNTRLKPPHKLHPNFTSLGENIWTGSVPIFSVSSAITNWYDEIQDYDFKTRICKKVCGHYTQVVWADSYKVGCAVQFCPKVSGFDALSNGAHFICNYGPGGNYPTWPYKRGATCSACPNNDKCLDNLCVNRQRDQVKRYYSVVYPGWPIYPRNR |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
Gene Name | GLIPR1 GLI pathogenesis-related 1 [ Homo sapiens ] |
Official Symbol | GLIPR1 |
Synonyms | GLIPR1; GLI pathogenesis-related 1; GLI pathogenesis related 1 (glioma); glioma pathogenesis-related protein 1; GliPR; RTVP1; gliPR 1; protein RTVP-1; GLI pathogenesis-related 1 (glioma); testes-specific vespid and pathogenesis protein 1; related to testis-specific, vespid, and pathogenesis proteins 1; GLIPR; CRISP7; |
Gene ID | 11010 |
mRNA Refseq | NM_006851 |
Protein Refseq | NP_006842 |
MIM | 602692 |
UniProt ID | P48060 |
◆ Recombinant Proteins | ||
GLIPR1-3190H | Recombinant Human GLIPR1 protein(Met1-Arg232), His-tagged | +Inquiry |
GLIPR1-4959H | Recombinant Human GLIPR1 Protein, GST-tagged | +Inquiry |
GLIPR1-157M | Recombinant Mouse Glipr1, His tagged | +Inquiry |
RFL36506HF | Recombinant Full Length Human Glioma Pathogenesis-Related Protein 1(Glipr1) Protein, His-Tagged | +Inquiry |
GLIPR1-1867R | Recombinant Rhesus monkey GLIPR1 Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
GLIPR1-2392HCL | Recombinant Human GLIPR1 cell lysate | +Inquiry |
GLIPR1-807MCL | Recombinant Mouse GLIPR1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All GLIPR1 Products
Required fields are marked with *
My Review for All GLIPR1 Products
Required fields are marked with *