Recombinant Full Length Mouse High Affinity Immunoglobulin Epsilon Receptor Subunit Beta(Ms4A2) Protein, His-Tagged
Cat.No. : | RFL28670MF |
Product Overview : | Recombinant Full Length Mouse High affinity immunoglobulin epsilon receptor subunit beta(Ms4a2) Protein (P20490) (1-235aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mus musculus |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length (1-235) |
Form : | Lyophilized powder |
AA Sequence : | MDTENRSRADLALPNPQESSSAPDIELLEASPAKAAPPKQTWRTFLKKELEFLGATQILV GLICLCFGTIVCSVLYVSDFDEEVLLLYKLGYPFWGAVLFVLSGFLSIISERKNTLYLVR GSLGANIVSSIAAGTGIAMLILNLTNNFAYMNNCKNVTEDDGCFVASFTTELVLMMLFLT ILAFCSAVLFTIYRIGQELESKKVPDDRLYEELNVYSPIYSELEDKGETSSPVDS |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | Ms4a2 |
Synonyms | Ms4a2; Fce1b; Fcer1b; Ms4a1; High affinity immunoglobulin epsilon receptor subunit beta; FcERI; Fc epsilon receptor I beta-chain; IgE Fc receptor subunit beta; Membrane-spanning 4-domains subfamily A member 2 |
UniProt ID | P20490 |
◆ Recombinant Proteins | ||
MS4A2-151H | Recombinant Human MS4A2 Protein, DYKDDDDK-tagged | +Inquiry |
MS4A2-3444R | Recombinant Rat MS4A2 Protein, His (Fc)-Avi-tagged | +Inquiry |
MS4A2-3785R | Recombinant Rat MS4A2 Protein | +Inquiry |
RFL34685RF | Recombinant Full Length Rat High Affinity Immunoglobulin Epsilon Receptor Subunit Beta(Ms4A2) Protein, His-Tagged | +Inquiry |
MS4A2-5634H | Recombinant Human MS4A2 Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
MS4A2-4126HCL | Recombinant Human MS4A2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Ms4a2 Products
Required fields are marked with *
My Review for All Ms4a2 Products
Required fields are marked with *
0
Inquiry Basket