Recombinant Full Length Human MS4A2 Protein, GST-tagged
| Cat.No. : | MS4A2-6540HF | 
| Product Overview : | Human MS4A2 full-length ORF ( NP_000130.1, 1 a.a. - 244 a.a.) recombinant protein with GST-tag at N-terminal. | 
- Specification
 - Gene Information
 - Related Products
 - Download
 
| Species : | Human | 
| Source : | In Vitro Cell Free System | 
| Tag : | GST | 
| Protein Length : | 244 amino acids | 
| Description : | The allergic response involves the binding of allergen to receptor-bound IgE followed by cell activation and the release of mediators responsible for the manifestations of allergy. The IgE-receptor, a tetramer composed of an alpha, beta, and 2 disulfide-linked gamma chains, is found on the surface of mast cells and basophils. This gene encodes the beta subunit of the high affinity IgE receptor which is a member of the membrane-spanning 4A gene family. Members of this nascent protein family are characterized by common structural features and similar intron/exon splice boundaries and display unique expression patterns among hematopoietic cells and nonlymphoid tissues. This family member is localized to 11q12, among a cluster of family members. Alternative splicing results in multiple transcript variants encoding different isoforms | 
| Molecular Mass : | 52.9 kDa | 
| AA Sequence : | MDTESNRRANLALPQEPSSVPAFEVLEISPQEVSSGRLLKSASSPPLHTWLTVLKKEQEFLGVTQILTAMICLCFGTVVCSVLDISHIEGDIFSSFKAGYPFWGAIFFSISGMLSIISERRNATYLVRGSLGANTASSIAGGTGITILIINLKKSLAYIHIHSCQKFFETKCFMASFSTEIVVMMLFLTILGLGSAVSLTICGAGEELKGNKVPEDRVYEELNIYSATYSELEDPGEMSPPIDL | 
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array  | 
                                
| Notes : | Best use within three months from the date of receipt of this protein. | 
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. | 
| Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. | 
| Gene Name | MS4A2 membrane-spanning 4-domains, subfamily A, member 2 [ Homo sapiens ] | 
| Official Symbol | MS4A2 | 
| Synonyms | MS4A2; membrane-spanning 4-domains, subfamily A, member 2; APY, FCER1B, IgE responsiveness (atopic) , IGER, membrane spanning 4 domains, subfamily A, member 2 (Fc fragment of IgE, high affinity I, receptor for; beta polypeptide); high affinity immunoglobulin epsilon receptor subunit beta; Fc fragment of IgE; high affinity I; receptor for; beta polypeptide; MS4A1; igE Fc receptor subunit beta; high affinity IgE receptor beta subunit; immunoglobulin E receptor, high affinity, beta polypeptide; Fc fragment of IgE, high affinity I, receptor for; beta polypeptide; High affinity immunoglobulin epsilon receptor beta-subunit (FcERI) (IgE Fc receptor, beta-subunit) (Fc epsilon receptor I beta-chain); APY; IGEL; IGER; ATOPY; FCERI; IGHER; FCER1B; | 
| Gene ID | 2206 | 
| mRNA Refseq | NM_000139 | 
| Protein Refseq | NP_000130 | 
| MIM | 147138 | 
| UniProt ID | Q01362 | 
| ◆ Recombinant Proteins | ||
| MS4A2-6540HF | Recombinant Full Length Human MS4A2 Protein, GST-tagged | +Inquiry | 
| MS4A2-5634H | Recombinant Human MS4A2 Protein, GST-tagged | +Inquiry | 
| RFL34685RF | Recombinant Full Length Rat High Affinity Immunoglobulin Epsilon Receptor Subunit Beta(Ms4A2) Protein, His-Tagged | +Inquiry | 
| MS4A2-151H | Recombinant Human MS4A2 Protein, DYKDDDDK-tagged | +Inquiry | 
| MS4A2-3785R | Recombinant Rat MS4A2 Protein | +Inquiry | 
| ◆ Cell & Tissue Lysates | ||
| MS4A2-4126HCL | Recombinant Human MS4A2 293 Cell Lysate | +Inquiry | 
Not For Human Consumption!
Inquiry
- Reviews (0)
 - Q&As (0)
 
Ask a Question for All MS4A2 Products
Required fields are marked with *
My Review for All MS4A2 Products
Required fields are marked with *
  
        
    
      
            