Recombinant Full Length Mouse Ileal Sodium/Bile Acid Cotransporter(Slc10A2) Protein, His-Tagged
Cat.No. : | RFL30289MF |
Product Overview : | Recombinant Full Length Mouse Ileal sodium/bile acid cotransporter(Slc10a2) Protein (P70172) (1-348aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mus musculus |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length (1-348) |
Form : | Lyophilized powder |
AA Sequence : | MDNSSVCPPNATVCEGDSCVVPESNFNAILNTVMSTVLTILLAMVMFSMGCNVEVHKFLG HIKRPWGIFVGFLCQFGIMPLTGFILSVASGILPVQAVVVLIMGCCPGGTGSNILAYWID GDMDLSVSMTTCSTLLALGMMPLCLFVYTKMWVDSGTIVIPYDSIGISLVALVIPVSFGM FVNHKWPQKAKIILKIGSITGVILIVLIAVIGGILYQSAWIIEPKLWIIGTIFPIAGYSL GFFLARLAGQPWYRCRTVALETGMQNTQLCSTIVQLSFSPEDLNLVFTFPLIYTVFQLVF AAVILGIYVTYRKCYGKNDAEFLEKTDNEMDSRPSFDETNKGFQPDEK |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | Slc10a2 |
Synonyms | Slc10a2; Ntcp2; Ileal sodium/bile acid cotransporter; Apical sodium-dependent bile acid transporter; ASBT; Ileal Na(+/bile acid cotransporter; Ileal sodium-dependent bile acid transporter; IBAT; ISBT; Na(+-dependent ileal bile acid transporter; Sodium/tau |
UniProt ID | P70172 |
◆ Recombinant Proteins | ||
SLC10A2-01H | Recombinant Human SLC10A2 Protein | +Inquiry |
SLC10A2-5419R | Recombinant Rat SLC10A2 Protein | +Inquiry |
RFL8538OF | Recombinant Full Length Rabbit Ileal Sodium/Bile Acid Cotransporter(Slc10A2) Protein, His-Tagged | +Inquiry |
RFL34088CF | Recombinant Full Length Cricetulus Griseus Ileal Sodium/Bile Acid Cotransporter(Slc10A2) Protein, His-Tagged | +Inquiry |
SLC10A2-3123H | Recombinant Human SLC10A2 protein, His-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Slc10a2 Products
Required fields are marked with *
My Review for All Slc10a2 Products
Required fields are marked with *