Recombinant Full Length Mouse Insulin-Induced Gene 1 Protein(Insig1) Protein, His-Tagged
Cat.No. : | RFL12905MF |
Product Overview : | Recombinant Full Length Mouse Insulin-induced gene 1 protein(Insig1) Protein (Q8BGI3) (1-259aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mus musculus |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length (1-259) |
Form : | Lyophilized powder |
AA Sequence : | MPRLHDHVWNYPSAGAARPYSLPRGMIAAAACPQGPGVPEPEHAPRGQRAGTTGCSARPG SWHHDLVQRSLVLFSFGVVLALVLNLLQIQRNVTLFPDEVIATIFSSAWWVPPCCGTAAA VVGLLYPCIDSHLGEPHKFKREWASVMRCIAVFVGINHASAKLDFANNVQLSLTLAALSL GLWWTFDRSRSGLGLGITIAFLATLITQFLVYNGVYQYTSPDFLYIRSWLPCIFFSGGVT VGNIGRQLAMGVPEKPHSD |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | Insig1 |
Synonyms | Insig1; Insulin-induced gene 1 protein; INSIG-1 |
UniProt ID | Q8BGI3 |
◆ Recombinant Proteins | ||
INSIG1-2734R | Recombinant Rat INSIG1 Protein, His (Fc)-Avi-tagged | +Inquiry |
RFL8821XF | Recombinant Full Length Xenopus Laevis Insulin-Induced Gene 1 Protein(Insig1) Protein, His-Tagged | +Inquiry |
INSIG1-4562M | Recombinant Mouse INSIG1 Protein, His (Fc)-Avi-tagged | +Inquiry |
RFL12905MF | Recombinant Full Length Mouse Insulin-Induced Gene 1 Protein(Insig1) Protein, His-Tagged | +Inquiry |
INSIG1-2654C | Recombinant Chicken INSIG1 | +Inquiry |
◆ Cell & Tissue Lysates | ||
INSIG1-5193HCL | Recombinant Human INSIG1 293 Cell Lysate | +Inquiry |
INSIG1-5194HCL | Recombinant Human INSIG1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Insig1 Products
Required fields are marked with *
My Review for All Insig1 Products
Required fields are marked with *
0
Inquiry Basket