Recombinant Full Length Mouse Killer Cell Lectin-Like Receptor Subfamily G Member 1(Klrg1) Protein, His-Tagged
Cat.No. : | RFL33120MF |
Product Overview : | Recombinant Full Length Mouse Killer cell lectin-like receptor subfamily G member 1(Klrg1) Protein (O88713) (1-188aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mus musculus |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length (1-188) |
Form : | Lyophilized powder |
AA Sequence : | MADSSIYSTLELPEAPQVQDESRWKLKAVLHRPHLSRFAMVALGLLTVILMSLLMYQRILCCGSKDSTCSHCPSCPILWTRNGSHCYYFSMEKKDWNSSLKFCADKGSHLLTFPDNQGVKLFGEYLGQDFYWIGLRNIDGWRWEGGPALSLRILTNSLIQRCGAIHRNGLQASSCEVALQWICKKVLY |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | Klrg1 |
Synonyms | Klrg1; Mafa; Killer cell lectin-like receptor subfamily G member 1; Mast cell function-associated antigen 2F1 |
UniProt ID | O88713 |
◆ Recombinant Proteins | ||
KLRG1-0321H | Active Recombinant Human KLRG1 protein, His-tagged | +Inquiry |
Klrg1-784M | Recombinant Mouse Klrg1 protein, hFc-tagged | +Inquiry |
Klrg1-1054M | Active Recombinant Mouse Klrg1 Protein, Fc Chimera | +Inquiry |
KLRG1-2955R | Recombinant Rat KLRG1 Protein, His (Fc)-Avi-tagged | +Inquiry |
KLRG1-723H | Recombinant Human KLRG1 | +Inquiry |
◆ Cell & Tissue Lysates | ||
KLRG1-950HCL | Recombinant Human KLRG1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Klrg1 Products
Required fields are marked with *
My Review for All Klrg1 Products
Required fields are marked with *