Recombinant Full Length Mouse Leukocyte Surface Antigen Cd47(Cd47) Protein, His-Tagged
| Cat.No. : | RFL14932MF |
| Product Overview : | Recombinant Full Length Mouse Leukocyte surface antigen CD47(Cd47) Protein (Q61735) (19-303aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Mouse |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | Full Length of Mature Protein (19-303) |
| Form : | Lyophilized powder |
| AA Sequence : | QLLFSNVNSIEFTSCNETVVIPCIVRNVEAQSTEEMFVKWKLNKSYIFIYDGNKNSTTTD QNFTSAKISVSDLINGIASLKMDKRDAMVGNYTCEVTELSREGKTVIELKNRTVSWFSPN EKILIVIFPILAILLFWGKFGILTLKYKSSHTNKRIILLLVAGLVLTVIVVVGAILLIPG EKPVKNASGLGLIVISTGILILLQYNVFMTAFGMTSFTIAILITQVLGYVLALVGLCLCI MACEPVHGPLLISGLGIIALAELLGLVYMKFVASNQRTIQPPRNR |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
| Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
| Gene Name | Cd47 |
| Synonyms | Cd47; Leukocyte surface antigen CD47; Integrin-associated protein; IAP; CD antigen CD47 |
| UniProt ID | Q61735 |
| ◆ Recombinant Proteins | ||
| CD47-382M | Active Recombinant Mouse CD47 protein, His-tagged | +Inquiry |
| Cd47-7480RAF555 | Recombinant Rat Cd47 Protein, hFc-tagged, Alexa Fluor 555 conjugated | +Inquiry |
| CD47-3292H | Recombinant Human CD47 protein, His-tagged, low endotoxin | +Inquiry |
| CD47-674C | Recombinant Cynomolgus/Rhesus macaque CD47 protein, His-tagged | +Inquiry |
| CD47-40H | Recombinant Human CD47 protein, hIgG-His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| CD47-1363RCL | Recombinant Rat CD47 cell lysate | +Inquiry |
| CD47-850HCL | Recombinant Human CD47 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Cd47 Products
Required fields are marked with *
My Review for All Cd47 Products
Required fields are marked with *
