Recombinant Full Length Mouse Linker For Activation Of T-Cells Family Member 1(Lat) Protein, His-Tagged
Cat.No. : | RFL20533MF |
Product Overview : | Recombinant Full Length Mouse Linker for activation of T-cells family member 1(Lat) Protein (O54957) (1-242aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mus musculus |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-242) |
Form : | Lyophilized powder |
AA Sequence : | MEADALSPVGLGLLLLPFLVTLLAALCVRCRELPVSYDSTSTESLYPRSILIKPPQITVPRTPAVSYPLVTSFPPLRQPDLLPIPRSPQPLGGSHRMPSSQQNSDDANSVASYENQEPACKNVDADEDEDDYPNGYLVVLPDSSPAAVPVVSSAPVPSNPDLGDSAFSVESCEDYVNVPESEESAEASLDGSREYVNVSPEQQPVTRAELASVNSQEVEDEGEEEGVDGEEAPDYENLQELN |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | Lat |
Synonyms | Lat; Linker for activation of T-cells family member 1; 36 kDa phospho-tyrosine adapter protein; pp36; p36-38 |
UniProt ID | O54957 |
◆ Recombinant Proteins | ||
SLC8A1-4316R | Recombinant Rhesus monkey SLC8A1 Protein, His-tagged | +Inquiry |
FGF1-2902H | Recombinant Human FGF1 protein, His-SUMO-tagged | +Inquiry |
OGFOD1-736H | Recombinant Human OGFOD1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
RFL21261PF | Recombinant Full Length Prochlorococcus Marinus Atp Synthase Subunit B(Atpf) Protein, His-Tagged | +Inquiry |
XDH-9951HFL | Recombinant Full Length Human XDH protein, Flag-tagged | +Inquiry |
◆ Native Proteins | ||
slo-01S | Active Native Streptococcus pyogenes Streptolysin O protein | +Inquiry |
CKB-46M | Native Mouse Creatine Kinase, Brain (CKB) Protein | +Inquiry |
CA19-9-01H | Active Native Human CA19-9 protein | +Inquiry |
PLD-17S | Active Native Streptomyces chromofuscus Phospholipase D | +Inquiry |
HPIV1ag-276V | Native Parainfluenza Virus type 1(strain Sendai) Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
MAP2K5-4509HCL | Recombinant Human MAP2K5 293 Cell Lysate | +Inquiry |
CC2D1B-7798HCL | Recombinant Human CC2D1B 293 Cell Lysate | +Inquiry |
SULF1-1360HCL | Recombinant Human SULF1 293 Cell Lysate | +Inquiry |
LOC650128-899HCL | Recombinant Human LOC650128 cell lysate | +Inquiry |
NRP1-811CCL | Recombinant Cynomolgus NRP1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Lat Products
Required fields are marked with *
My Review for All Lat Products
Required fields are marked with *
0
Inquiry Basket