Recombinant Human LAT Protein, His-tagged

• Cat.No.: LAT-001H
• Product Overview: Recombinant Human LAT Protein, His-tagged, expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 30-113 aa
• Tag: His
• Molecular Mass: 10 kDa
• AA Sequence: MHRLPGSYDSTSSDSLYPRGIQFKRPHTVAPWPPAYPPVTSYPPLSQPDLLPIPRSPQPLGGSHRTPSSRRDSDGANSVASYENEHHHHHHHH
• Purity: >90% by SDS-PAGE
• Storage: Store it under sterile conditions at -20 to -80 °C. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
• Concentration: 0.61mg/ml by BCA
• Storage Buffer: Sterile PBS, pH7.4, 10% Glycerol, 8% Trehalose

Gene Information

• Gene Name: LAT linker for activation of T cells [ Homo sapiens (human) ]
• Official Symbol: LAT
• Synonyms: LAT1; pp36; IMD52; LAT
• Gene ID: 27040
• MIM: 602354
• UniProt ID: O43561