Recombinant Human LAT Protein, His-tagged
| Cat.No. : | LAT-001H |
| Product Overview : | Recombinant Human LAT Protein, His-tagged, expressed in E. coli. |
| Availability | December 30, 2025 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 30-113 aa |
| Tag : | His |
| Molecular Mass : | 10 kDa |
| AA Sequence : | MHRLPGSYDSTSSDSLYPRGIQFKRPHTVAPWPPAYPPVTSYPPLSQPDLLPIPRSPQPLGGSHRTPSSRRDSDGANSVASYENEHHHHHHHH |
| Purity : | >90% by SDS-PAGE |
| Storage : | Store it under sterile conditions at -20 to -80 °C. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles. |
| Concentration : | 0.61mg/ml by BCA |
| Storage Buffer : | Sterile PBS, pH7.4, 10% Glycerol, 8% Trehalose |
| Gene Name | LAT linker for activation of T cells [ Homo sapiens (human) ] |
| Official Symbol | LAT |
| Synonyms | LAT1; pp36; IMD52; LAT |
| Gene ID | 27040 |
| MIM | 602354 |
| UniProt ID | O43561 |
| ◆ Recombinant Proteins | ||
| LAT-3359R | Recombinant Rat LAT Protein | +Inquiry |
| LAT-3015R | Recombinant Rat LAT Protein, His (Fc)-Avi-tagged | +Inquiry |
| LAT-001H | Recombinant Human LAT Protein, His-tagged | +Inquiry |
| LAT-8969M | Recombinant Mouse LAT Protein | +Inquiry |
| LAT-29047TH | Recombinant Human LAT, His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| LAT-4817HCL | Recombinant Human LAT 293 Cell Lysate | +Inquiry |
| LAT-4816HCL | Recombinant Human LAT 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All LAT Products
Required fields are marked with *
My Review for All LAT Products
Required fields are marked with *
