Recombinant Human LAT Protein, His-tagged
Cat.No. : | LAT-001H |
Product Overview : | Recombinant Human LAT Protein, His-tagged, expressed in E. coli. |
Availability | October 15, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 30-113 aa |
Tag : | His |
Molecular Mass : | 10 kDa |
AA Sequence : | MHRLPGSYDSTSSDSLYPRGIQFKRPHTVAPWPPAYPPVTSYPPLSQPDLLPIPRSPQPLGGSHRTPSSRRDSDGANSVASYENEHHHHHHHH |
Purity : | >90% by SDS-PAGE |
Storage : | Store it under sterile conditions at -20 to -80 °C. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles. |
Concentration : | 0.61mg/ml by BCA |
Storage Buffer : | Sterile PBS, pH7.4, 10% Glycerol, 8% Trehalose |
Gene Name | LAT linker for activation of T cells [ Homo sapiens (human) ] |
Official Symbol | LAT |
Synonyms | LAT1; pp36; IMD52; LAT |
Gene ID | 27040 |
MIM | 602354 |
UniProt ID | O43561 |
◆ Cell & Tissue Lysates | ||
LAT-4817HCL | Recombinant Human LAT 293 Cell Lysate | +Inquiry |
LAT-4816HCL | Recombinant Human LAT 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All LAT Products
Required fields are marked with *
My Review for All LAT Products
Required fields are marked with *