Recombinant Human LAT Protein, His-tagged
Cat.No. : | LAT-001H |
Product Overview : | Recombinant Human LAT Protein, His-tagged, expressed in E. coli. |
Availability | February 08, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
ProteinLength : | 30-113 aa |
Tag : | His |
Molecular Mass : | 10 kDa |
AA Sequence : | MHRLPGSYDSTSSDSLYPRGIQFKRPHTVAPWPPAYPPVTSYPPLSQPDLLPIPRSPQPLGGSHRTPSSRRDSDGANSVASYENEHHHHHHHH |
Purity : | >90% by SDS-PAGE |
Storage : | Store it under sterile conditions at -20 to -80 °C. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles. |
Concentration : | 0.61mg/ml by BCA |
Storage Buffer : | Sterile PBS, pH7.4, 10% Glycerol, 8% Trehalose |
Gene Name | LAT linker for activation of T cells [ Homo sapiens (human) ] |
Official Symbol | LAT |
Synonyms | LAT1; pp36; IMD52; LAT |
Gene ID | 27040 |
MIM | 602354 |
UniProt ID | O43561 |
◆ Native Proteins | ||
20S Immunoproteasome-224C | Active Native Cynomolgus monkey 20S Immunoproteasome protein | +Inquiry |
dsbA-8328E | Native E.coli dsbA | +Inquiry |
Complement C3d-48H | Native Human Complement C3d | +Inquiry |
Collagen-01B | Native Bovine Type II Collagen | +Inquiry |
COL2A1-15C | Native Chicken COL2A1 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
LRFN1-1030HCL | Recombinant Human LRFN1 cell lysate | +Inquiry |
RNF215-1002HCL | Recombinant Human RNF215 cell lysate | +Inquiry |
SW-13-1727H | SW-13 (human small cell carcinoma of the adrenal cortex) nuclear extract lysate | +Inquiry |
PANK2-3445HCL | Recombinant Human PANK2 293 Cell Lysate | +Inquiry |
NCR2-2109HCL | Recombinant Human NCR2 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All LAT Products
Required fields are marked with *
My Review for All LAT Products
Required fields are marked with *
0
Inquiry Basket