Recombinant Full Length Mouse Membrane-Spanning 4-Domains Subfamily A Member 15(Ms4A15) Protein, His-Tagged
Cat.No. : | RFL27949MF |
Product Overview : | Recombinant Full Length Mouse Membrane-spanning 4-domains subfamily A member 15(Ms4a15) Protein (Q3UPL6) (1-245aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mus musculus |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length (1-245) |
Form : | Lyophilized powder |
AA Sequence : | MWERRGRGESAAGTAAVASRNASGLRPPPAILPTSMCQPPGIMQFEESQLGAQAPRATQP PDLRPMETFLTGEPKALGTVQILIGLIHLGFGSVLLMVRRGHLGMLFIEGGVPFWGGACF IISGSLSVAAERNHTSCLLKSSLGTNILSAMAAFAGTAILLMDFGVTNWDVGRGYLAVLT IFTILEFFIAVIATHFGCQATRAQTNASVIFLPNAFGTDFNIPSPAVSPPPAYDNVAYMP KESSE |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | Ms4a15 |
Synonyms | Ms4a15; Membrane-spanning 4-domains subfamily A member 15 |
UniProt ID | Q3UPL6 |
◆ Recombinant Proteins | ||
MS4A15-10116M | Recombinant Mouse MS4A15 Protein | +Inquiry |
Ms4a15-4179M | Recombinant Mouse Ms4a15 Protein, Myc/DDK-tagged | +Inquiry |
RFL27949MF | Recombinant Full Length Mouse Membrane-Spanning 4-Domains Subfamily A Member 15(Ms4A15) Protein, His-Tagged | +Inquiry |
MS4A15-161H | Recombinant Human MS4A15 Protein, MYC/DDK-tagged, C13 and N15-labeled | +Inquiry |
MS4A15-5275H | Recombinant Human MS4A15 Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
MS4A15-4127HCL | Recombinant Human MS4A15 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Ms4a15 Products
Required fields are marked with *
My Review for All Ms4a15 Products
Required fields are marked with *