Recombinant Human MS4A15 Protein, GST-tagged
| Cat.No. : | MS4A15-5275H |
| Product Overview : | Human MGC35295 full-length ORF ( AAH31610.1, 1 a.a. - 147 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | MS4A15 (Membrane Spanning 4-Domains A15) is a Protein Coding gene. An important paralog of this gene is MS4A12. |
| Molecular Mass : | 41.91 kDa |
| AA Sequence : | MVRRGHVGIFFIEGGVPFWGGACFIISGSLSVAAEKNHTSCLVRSSLGTNILSVMAAFAGTAILLMDFGVTNRDVDRGYLAVLTIFTVLEFFTAVIAMHFGCQAIHAQASAPVIFLPNAFSADFNIPSPAASAPPAYDNVAYAQGVV |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | MS4A15 membrane-spanning 4-domains, subfamily A, member 15 [ Homo sapiens ] |
| Official Symbol | MS4A15 |
| Synonyms | MS4A15; membrane-spanning 4-domains, subfamily A, member 15; membrane-spanning 4-domains subfamily A member 15; FLJ34527; MGC35295; |
| Gene ID | 219995 |
| mRNA Refseq | NM_001098835 |
| Protein Refseq | NP_001092305 |
| UniProt ID | Q8N5U1 |
| ◆ Cell & Tissue Lysates | ||
| MS4A15-4127HCL | Recombinant Human MS4A15 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MS4A15 Products
Required fields are marked with *
My Review for All MS4A15 Products
Required fields are marked with *
