Recombinant Full Length Mouse Mln64 N-Terminal Domain Homolog(Stard3Nl) Protein, His-Tagged
Cat.No. : | RFL9776MF |
Product Overview : | Recombinant Full Length Mouse MLN64 N-terminal domain homolog(Stard3nl) Protein (Q9DCI3) (1-235aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mus musculus |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length (1-235) |
Form : | Lyophilized powder |
AA Sequence : | MNHLPEHMENTLTGSQSSHASLRDIHSINPAQLMARIESYEGREKKGISDVRRTFCLFVT FDLLFVTLLWIIELNVNGGIENTLKKEVIHYDYYSSYFDIFLLAVFRFKVLILGYAVCRL RHWWAIALTTAVTSAFLLAKVILSKLFSQGAFGYVLPIISFILAWIETWFLDFKVLPQEA EEENRLLLVQDASERAALIPAGLSDGQFYSPPESEAGSEEEAEEKQESEKPLLEL |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | Stard3nl |
Synonyms | Stard3nl; Mentho; STARD3 N-terminal-like protein; MLN64 N-terminal domain homolog |
UniProt ID | Q9DCI3 |
◆ Recombinant Proteins | ||
RFL23358HF | Recombinant Full Length Human Mln64 N-Terminal Domain Homolog(Stard3Nl) Protein, His-Tagged | +Inquiry |
STARD3NL-4512R | Recombinant Rhesus monkey STARD3NL Protein, His-tagged | +Inquiry |
STARD3NL-30163H | Recombinant Human STARD3NL protein, GST-tagged | +Inquiry |
STARD3NL-4328R | Recombinant Rhesus Macaque STARD3NL Protein, His (Fc)-Avi-tagged | +Inquiry |
RFL9776MF | Recombinant Full Length Mouse Mln64 N-Terminal Domain Homolog(Stard3Nl) Protein, His-Tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
STARD3NL-639HCL | Recombinant Human STARD3NL lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Stard3nl Products
Required fields are marked with *
My Review for All Stard3nl Products
Required fields are marked with *
0
Inquiry Basket