Recombinant Human STARD3NL protein, GST-tagged
Cat.No. : | STARD3NL-30163H |
Product Overview : | Recombinant Human STARD3NL (162-234 aa) protein, fused to GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | Ile162-Leu234 |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
AA Sequence : | ILAWIETWFLDFKVLPQEAEEENRLLIVQDASERAALIPGGLSDGQFYSPPESEAGSEEAEEKQDSEKPLLEL |
Purity : | 95%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Stability : | Store for up to 12 months at -20°C to -80°C as lyophilized powder. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Gene Name | STARD3NL STARD3 N-terminal like [ Homo sapiens (human) ] |
Official Symbol | STARD3NL |
Synonyms | STARD3NL; MENTHO |
Gene ID | 83930 |
mRNA Refseq | NM_001363339 |
Protein Refseq | NP_00135026 |
◆ Recombinant Proteins | ||
STARD3NL-4328R | Recombinant Rhesus Macaque STARD3NL Protein, His (Fc)-Avi-tagged | +Inquiry |
STARD3NL-8781M | Recombinant Mouse STARD3NL Protein, His (Fc)-Avi-tagged | +Inquiry |
STARD3NL-16101M | Recombinant Mouse STARD3NL Protein | +Inquiry |
STARD3NL-30163H | Recombinant Human STARD3NL protein, GST-tagged | +Inquiry |
RFL23358HF | Recombinant Full Length Human Mln64 N-Terminal Domain Homolog(Stard3Nl) Protein, His-Tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
STARD3NL-639HCL | Recombinant Human STARD3NL lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All STARD3NL Products
Required fields are marked with *
My Review for All STARD3NL Products
Required fields are marked with *
0
Inquiry Basket