Recombinant Full Length Mouse Muscarinic Acetylcholine Receptor M2(Chrm2) Protein, His-Tagged
Cat.No. : | RFL20261MF |
Product Overview : | Recombinant Full Length Mouse Muscarinic acetylcholine receptor M2(Chrm2) Protein (Q9ERZ4) (1-466aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mus musculus |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length (1-466) |
Form : | Lyophilized powder |
AA Sequence : | MNNSTNSSNNGLAITSPYKTFEVVFIVLVAGSLSLVTIIGNILVMVSIKVNRHLQTVNNY FLFSLACADLIIGVFSMNLYTLYTVIGYWPLGPVVCDLWLALDYVVSNASVMNLLIISFD RYFCVTKPLTYPVKRTTKMAGMMIAAAWVLSFILWAPAILFWQFIVGVRTVEDGECYIQF FSNAAVTFGTAIAAFYLPVIIMTVLYWHISRASKSRIKKEKKEPVANQDPVSPSLVQGRI VKPNNNNMPGGDGGLEHNKIQNGKAPRDGGTENCVQGEEKESSNDSTSVSAVASNMRDDE ITQDENTVSTSLGHSKDDNSRQTCIKIVTKTQKGDACTPTSTTVELVGSSGQNGDEKQNI VARKIVKMTKQPAKKKPPPSREKKVTRTILAILLAFIITWAPYNVMVLINTFCAPCIPNT VWTIGYWLCYINSTINPACYALCNATFKKTFKHLLMCHYKNIGATR |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | Chrm2 |
Synonyms | Chrm2; Chrm-2; Muscarinic acetylcholine receptor M2 |
UniProt ID | Q9ERZ4 |
◆ Recombinant Proteins | ||
CHRM2-175H | Recombinant Human CHRM2 | +Inquiry |
CHRM2-482H | Recombinant Human CHRM2 Full Length Transmembrane protein, Flag Tag(Nanodisc) | +Inquiry |
RFL33112RF | Recombinant Full Length Rat Muscarinic Acetylcholine Receptor M2(Chrm2) Protein, His-Tagged | +Inquiry |
CHRM2-301527H | Recombinant Human PCHRM2 protein, GST-tagged | +Inquiry |
CHRM2-1386R | Recombinant Rat CHRM2 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
CHRM2-7520HCL | Recombinant Human CHRM2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Chrm2 Products
Required fields are marked with *
My Review for All Chrm2 Products
Required fields are marked with *
0
Inquiry Basket