Recombinant Full Length Mouse Palmitoyltransferase Zdhhc3(Zdhhc3) Protein, His-Tagged
| Cat.No. : | RFL22670MF |
| Product Overview : | Recombinant Full Length Mouse Palmitoyltransferase ZDHHC3(Zdhhc3) Protein (Q8R173) (1-299aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Mouse |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | Full Length (1-299) |
| Form : | Lyophilized powder |
| AA Sequence : | MMLIPTHHFRDIERKPEYLQPEKCAPPPFPGPAGAMWFIRDGCGIACAIVTWFLVLYAEF VVLFVMLVPSRDYAYSIINGIVFNLLAFLALASHCRAMLTDPGAVPKGNATKEFIESLQL KPGQVVYKCPKCCSIKPDRAHHCSVCKRCIRKMDHHCPWVNNCVGENNQKYFVLFTMYIA LISLHALIMVGFHFLHCFEEDWTKCSSFSPPTTVILLILLCFEALLFLIFTSVMFGTQVH SICTDETGIEQLKKEERRWAKKTKWMNMKAVFGHPFSLGWASPFATPDQGKADPYQYVV |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
| Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
| Gene Name | Zdhhc3 |
| Synonyms | Zdhhc3; Godz; Gramp1; Palmitoyltransferase ZDHHC3; Acyltransferase ZDHHC3; GABA-A receptor-associated membrane protein 1; Golgi-specific DHHC zinc finger protein; Zinc finger DHHC domain-containing protein 3; DHHC-3 |
| UniProt ID | Q8R173 |
| ◆ Recombinant Proteins | ||
| ZDHHC3-10320M | Recombinant Mouse ZDHHC3 Protein, His (Fc)-Avi-tagged | +Inquiry |
| ZDHHC3-18793M | Recombinant Mouse ZDHHC3 Protein | +Inquiry |
| RFL29410HF | Recombinant Full Length Human Palmitoyltransferase Zdhhc3(Zdhhc3) Protein, His-Tagged | +Inquiry |
| RFL22670MF | Recombinant Full Length Mouse Palmitoyltransferase Zdhhc3(Zdhhc3) Protein, His-Tagged | +Inquiry |
| ZDHHC3-642HF | Recombinant Full Length Human ZDHHC3 Protein, GST-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| ZDHHC3-748HCL | Recombinant Human ZDHHC3 lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Zdhhc3 Products
Required fields are marked with *
My Review for All Zdhhc3 Products
Required fields are marked with *
