Recombinant Human ZDHHC3 protein, GST-tagged

• Cat.No.: ZDHHC3-42H
• Product Overview: Recombinant Human ZDHHC3(1 a.a. - 299 a.a.) fused with GST tag at N-terminal was expressed in Wheat Germ.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Protein Length: 1-299 a.a.
• Description: ZDHHC3 played an important role in many functions.
• Form: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
• Molecular Mass: 60.6 kDa
• AA Sequence: MMLIPTHHFRNIERKPEYLQPEKCVPPPYPGPVGTMWFIRDGCGIACAIVTWFLVLYAEFVVLFVMLIPSRDYVY SIINGIVFNLLAFLALASHCRAMLTDPGAVPKGNATKEFIESLQLKPGQVVYKCPKCCSIKPDRAHHCSVCKRCI RKMDHHCPWVNNCVGENNQKYFVLFTMYIALISLHALIMVGFHFLHCFEEDWTKCSSFSPPTTVILLILLCFEGL LFLIFTSVMFGTQVHSICTDETGIEQLKKEERRWAKKTKWMNMKAVFGHPFSLGWASPFATPDQGKADPYQYVV
• Applications: Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.

Gene Information

• Gene Name: ZDHHC3 zinc finger, DHHC-type containing 3 [ Homo sapiens ]
• Official Symbol: ZDHHC3
• Synonyms: GODZ; DHHC-3; ZNF373
• Gene ID: 51304
• mRNA Refseq: NM_016598.2
• Protein Refseq: NP_057682.1
• UniProt ID: Q9NYG2
• Chromosome Location: 3p21.31
• Function: palmitoyltransferase activity;zinc ion binding