Recombinant Human ZDHHC3 protein, GST-tagged
| Cat.No. : | ZDHHC3-42H |
| Product Overview : | Recombinant Human ZDHHC3(1 a.a. - 299 a.a.) fused with GST tag at N-terminal was expressed in Wheat Germ. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Protein Length : | 1-299 a.a. |
| Description : | ZDHHC3 played an important role in many functions. |
| Form : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Molecular Mass : | 60.6 kDa |
| AA Sequence : | MMLIPTHHFRNIERKPEYLQPEKCVPPPYPGPVGTMWFIRDGCGIACAIVTWFLVLYAEFVVLFVMLIPSRDYVY SIINGIVFNLLAFLALASHCRAMLTDPGAVPKGNATKEFIESLQLKPGQVVYKCPKCCSIKPDRAHHCSVCKRCI RKMDHHCPWVNNCVGENNQKYFVLFTMYIALISLHALIMVGFHFLHCFEEDWTKCSSFSPPTTVILLILLCFEGL LFLIFTSVMFGTQVHSICTDETGIEQLKKEERRWAKKTKWMNMKAVFGHPFSLGWASPFATPDQGKADPYQYVV |
| Applications : | Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Gene Name | ZDHHC3 zinc finger, DHHC-type containing 3 [ Homo sapiens ] |
| Official Symbol | ZDHHC3 |
| Synonyms | GODZ; DHHC-3; ZNF373 |
| Gene ID | 51304 |
| mRNA Refseq | NM_016598.2 |
| Protein Refseq | NP_057682.1 |
| MIM | |
| UniProt ID | Q9NYG2 |
| Chromosome Location | 3p21.31 |
| Function | palmitoyltransferase activity;zinc ion binding; |
| ◆ Recombinant Proteins | ||
| RFL22670MF | Recombinant Full Length Mouse Palmitoyltransferase Zdhhc3(Zdhhc3) Protein, His-Tagged | +Inquiry |
| RFL29410HF | Recombinant Full Length Human Palmitoyltransferase Zdhhc3(Zdhhc3) Protein, His-Tagged | +Inquiry |
| ZDHHC3-42H | Recombinant Human ZDHHC3 protein, GST-tagged | +Inquiry |
| ZDHHC3-10320M | Recombinant Mouse ZDHHC3 Protein, His (Fc)-Avi-tagged | +Inquiry |
| ZDHHC3-642HF | Recombinant Full Length Human ZDHHC3 Protein, GST-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| ZDHHC3-748HCL | Recombinant Human ZDHHC3 lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ZDHHC3 Products
Required fields are marked with *
My Review for All ZDHHC3 Products
Required fields are marked with *



