Recombinant Human ZDHHC3 protein, GST-tagged
Cat.No. : | ZDHHC3-42H |
Product Overview : | Recombinant Human ZDHHC3(1 a.a. - 299 a.a.) fused with GST tag at N-terminal was expressed in Wheat Germ. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Protein Length : | 1-299 a.a. |
Description : | ZDHHC3 played an important role in many functions. |
Form : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Molecular Mass : | 60.6 kDa |
AA Sequence : | MMLIPTHHFRNIERKPEYLQPEKCVPPPYPGPVGTMWFIRDGCGIACAIVTWFLVLYAEFVVLFVMLIPSRDYVY SIINGIVFNLLAFLALASHCRAMLTDPGAVPKGNATKEFIESLQLKPGQVVYKCPKCCSIKPDRAHHCSVCKRCI RKMDHHCPWVNNCVGENNQKYFVLFTMYIALISLHALIMVGFHFLHCFEEDWTKCSSFSPPTTVILLILLCFEGL LFLIFTSVMFGTQVHSICTDETGIEQLKKEERRWAKKTKWMNMKAVFGHPFSLGWASPFATPDQGKADPYQYVV |
Applications : | Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Gene Name | ZDHHC3 zinc finger, DHHC-type containing 3 [ Homo sapiens ] |
Official Symbol | ZDHHC3 |
Synonyms | GODZ; DHHC-3; ZNF373 |
Gene ID | 51304 |
mRNA Refseq | NM_016598.2 |
Protein Refseq | NP_057682.1 |
MIM | |
UniProt ID | Q9NYG2 |
Chromosome Location | 3p21.31 |
Function | palmitoyltransferase activity;zinc ion binding; |
◆ Recombinant Proteins | ||
ZDHHC3-10320M | Recombinant Mouse ZDHHC3 Protein, His (Fc)-Avi-tagged | +Inquiry |
RFL29410HF | Recombinant Full Length Human Palmitoyltransferase Zdhhc3(Zdhhc3) Protein, His-Tagged | +Inquiry |
RFL22670MF | Recombinant Full Length Mouse Palmitoyltransferase Zdhhc3(Zdhhc3) Protein, His-Tagged | +Inquiry |
ZDHHC3-642HF | Recombinant Full Length Human ZDHHC3 Protein, GST-tagged | +Inquiry |
ZDHHC3-18793M | Recombinant Mouse ZDHHC3 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
ZDHHC3-748HCL | Recombinant Human ZDHHC3 lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ZDHHC3 Products
Required fields are marked with *
My Review for All ZDHHC3 Products
Required fields are marked with *
0
Inquiry Basket