Recombinant Full Length Mouse Platelet Glycoprotein Ib Beta Chain(Gp1Bb) Protein, His-Tagged
| Cat.No. : | RFL15947MF |
| Product Overview : | Recombinant Full Length Mouse Platelet glycoprotein Ib beta chain(Gp1bb) Protein (P56400) (27-206aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Mouse |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | Full Length of Mature Protein (27-206) |
| Form : | Lyophilized powder |
| AA Sequence : | PAPCSCAGTLVDCGRRGLTWASLPAAFPPDTTELVLTGNNLTALPPGLLDALPALRAAHLGANPWRCDCRLLPLRAWLAGRPERAPYRDLRCVAPPALRGRLLPYVAEDELRAACAPGLLCWGALVAQLALLVLGLLHALLLALLLGRLRRLRARARARSIQEFSLTAPLVAESARGGAS |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Applications : | SDS-PAGE |
| Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
| Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
| Gene Name | Gp1bb |
| Synonyms | Gp1bb; Platelet glycoprotein Ib beta chain; GP-Ib beta; GPIb-beta; GPIbB; CD antigen CD42c |
| UniProt ID | P56400 |
| ◆ Recombinant Proteins | ||
| GP1BB-5132H | Recombinant Human GP1BB Protein | +Inquiry |
| GP1BB-2247H | Recombinant Human GP1BB protein, His-tagged | +Inquiry |
| Gp1bb-5729M | Recombinant Mouse Gp1bb protein, His & T7-tagged | +Inquiry |
| GP1BB-15H | Active Recombinant Human GP1BB Protein (26-147aa), C-His-tagged | +Inquiry |
| GP1BB-7296Z | Recombinant Zebrafish GP1BB | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| GP1BB-2588HCL | Recombinant Human GP1BB cell lysate | +Inquiry |
| GP1BB-1243RCL | Recombinant Rat GP1BB cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Gp1bb Products
Required fields are marked with *
My Review for All Gp1bb Products
Required fields are marked with *
