Recombinant Full Length Mouse Potassium Channel Subfamily K Member 3(Kcnk3) Protein, His-Tagged
Cat.No. : | RFL21865MF |
Product Overview : | Recombinant Full Length Mouse Potassium channel subfamily K member 3(Kcnk3) Protein (O35111) (1-409aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mus musculus |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length (1-409) |
Form : | Lyophilized powder |
AA Sequence : | MKRQNVRTLALIVCTFTYLLVGAAVFDALESEPEMIERQRLELRQLELRARYNLSEGGYE ELERVVLRLKPHKAGVQWRFAGSFYFAITVITTIGYGHAAPSTDGGKVFCMFYALLGIPL TLVMFQSLGERINTFVRYLLHRAKRGLGMRHAEVSMANMVLIGFVSCISTLCIGAAAFSY YERWTFFQAYYYCFITLTTIGFGDYVALQKDQALQTQPQYVAFSFVYILTGLTVIGAFLN LVVLRFMTMNAEDEKRDAEHRALLTHNGQAVGLGGLSCLSGSLGDGVRPRDPVTCAAAAG GVGVGVGGSGFRNVYAEVLHFQSMCSCLWYKSREKLQYSIPMIIPRDLSTSDTCVEHSHS SPGGGGRYSDTPSHPCLCSGTQRSAISSVSTGLHSLAAFRGLMKRRSSV |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | Kcnk3 |
Synonyms | Kcnk3; Ctbak; Task; Task1; Potassium channel subfamily K member 3; Acid-sensitive potassium channel protein TASK-1; Cardiac two pore background K(+ channel; TWIK-related acid-sensitive K(+ channel 1; Two pore potassium channel KT3.1; Two pore K(+ channel |
UniProt ID | O35111 |
◆ Recombinant Proteins | ||
KCNK3-4747M | Recombinant Mouse KCNK3 Protein, His (Fc)-Avi-tagged | +Inquiry |
RFL18636HF | Recombinant Full Length Human Potassium Channel Subfamily K Member 3(Kcnk3) Protein, His&Myc-Tagged | +Inquiry |
KCNK3-32H | Recombinant Human KCNK3 protein, His-tagged | +Inquiry |
KCNK3-2382H | Recombinant Human KCNK3 Full Length Transmembrane protein, His&Myc-tagged | +Inquiry |
KCNK3-8532M | Recombinant Mouse KCNK3 Protein | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Kcnk3 Products
Required fields are marked with *
My Review for All Kcnk3 Products
Required fields are marked with *