Recombinant Full Length Mouse Relaxin-3 Receptor 1(Rxfp3) Protein, His-Tagged
Cat.No. : | RFL6922MF |
Product Overview : | Recombinant Full Length Mouse Relaxin-3 receptor 1(Rxfp3) Protein (Q8BGE9) (1-472aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mus musculus |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length (1-472) |
Form : | Lyophilized powder |
AA Sequence : | MQVASATPAATVRKAAAGDELSEFFALTPDLLEVANASGNASLQLQDLWWELGLELPDGA APGHPPGGGGAESTDTEARVRILISAVYWVVCALGLAGNLLVLYLMKSKQGWRKSSINLF VTNLALTDFQFVLTLPFWAVENALDFKWPFGKAMCKIVSMVTSMNMYASVFFLTAMSVAR YHSVASALKSHRTRGRGRGDCCGQSLRESCCFSAKVLCGLIWASAALASLPNAIFSTTIR VLGEELCLMHFPDKLLGWDRQFWLGLYHLQKVLLGFLLPLSIISLCYLLLVRFISDRRVV GTTDAVGAAAAPGGGLSTASARRRSKVTKSVTIVVLSFFLCWLPNQALTTWSILIKFNAV PFSQEYFQCQVYAFPVSVCLAHSNSCLNPILYCLVRREFRKALKNLLWRIASPSLTNMRP FTATTKPEPEDHGLQALAPLNAAAEPDLIYYPPGVVVYSGGRYDLLPSSSAY |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | Rxfp3 |
Synonyms | Rxfp3; Rln3r1; Salpr; Relaxin-3 receptor 1; RLN3 receptor 1; G protein-coupled receptor SALPR homolog; Relaxin family peptide receptor 3 |
UniProt ID | Q8BGE9 |
◆ Recombinant Proteins | ||
RFL21907HF | Recombinant Full Length Human Relaxin-3 Receptor 1(Rxfp3) Protein, His-Tagged | +Inquiry |
RXFP3-2478H | Recombinant Human RXFP3, GST-tagged | +Inquiry |
RFL6922MF | Recombinant Full Length Mouse Relaxin-3 Receptor 1(Rxfp3) Protein, His-Tagged | +Inquiry |
RXFP3-7042Z | Recombinant Zebrafish RXFP3 | +Inquiry |
◆ Cell & Tissue Lysates | ||
RXFP3-1553HCL | Recombinant Human RXFP3 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Rxfp3 Products
Required fields are marked with *
My Review for All Rxfp3 Products
Required fields are marked with *
0
Inquiry Basket