Recombinant Full Length Mouse SET nuclear oncogene Protein, Flag tagged

Cat.No. : Set-13MFL
Product Overview : Purified recombinant protein of Mouse SET nuclear oncogene (Set), with C-terminal MYC/DDK tag, expressed in HEK293T cells
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Mouse
Source : HEK293
Tag : Flag
Protein Length : 1-289 aa
Description : Multitasking protein, involved in apoptosis, transcription, nucleosome assembly and histone chaperoning. Isoform 2 anti-apoptotic activity is mediated by inhibition of the GZMA-activated DNase, NME1. In the course of cytotoxic T-lymphocyte (CTL)-induced apoptosis, GZMA cleaves SET, disrupting its binding to NME1 and releasing NME1 inhibition. Isoform 1 and isoform 2 are potent inhibitors of protein phosphatase 2A. Isoform 1 and isoform 2 inhibit EP300/CREBBP and PCAF-mediated acetylation of histones (HAT) and nucleosomes, most probably by masking the accessibility of lysines of histones to the acetylases. The predominant target for inhibition is histone H4. HAT inhibition leads to silencing of HAT-dependent transcription and prevents active demethylation of DNA. Both isoforms stimulate DNA replication of the adenovirus genome complexed with viral core proteins; however, isoform 2 specific activity is higher (By similarity).
Tag : C-Flag
Molecular Mass : 33.8 kDa
AA Sequence : MAPKRQSAILPQPKKPRPAAAPKLEDKSASPGLPKGEKEQQEAIEHIDEVQNEIDRLNEQASEEILKVEQKYNKLRQPFFQKRSELIAKIPNFWVTTFVNHPQVSALLGEEDEEALHYLTRVEVTEFEDIKSGYRIDFYFDENPYFENKVLSKEFHLNESGDPSSKSTEIKWKSGKDLTKRSSQTQNKASRKRQHEEPESFFTWFTDHSDAGADELGEVIKDDIWPNPLQYYLVPDMDDEEGEAEDDDDDDEEEEGLEDIDEEGDEDEGEEDDDEDEGEEGEEDEGEDDTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Notes : For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Stability : Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Storage : Store at -80 centigrade.
Storage Buffer : 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Concentration : >0.05 μg/μL as determined by microplate BCA method
Gene Name Set SET nuclear oncogene [ Mus musculus ]
Official Symbol Set
Synonyms SET; SET nuclear oncogene; protein SET; SET translocation; template-activating factor I; phosphatase 2A inhibitor I2PP2A; TAF-I; I-2PP2A; AA407739; StF-IT-1; 2610030F17Rik; 5730420M11Rik; MGC118419
Gene ID 56086
mRNA Refseq NM_023871
Protein Refseq NP_076360
UniProt ID Q9EQU5

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All Set Products

Required fields are marked with *

My Review for All Set Products

Required fields are marked with *

0
cart-icon
0
compare icon