Recombinant Full Length Mouse Syntaxin-1A(Stx1A) Protein, His-Tagged
Cat.No. : | RFL36193MF |
Product Overview : | Recombinant Full Length Mouse Syntaxin-1A(Stx1a) Protein (O35526) (1-288aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mus musculus |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length (1-288) |
Form : | Lyophilized powder |
AA Sequence : | MKDRTQELRTAKDSDDDDDVTVTVDRDRFMDEFFEQVEEIRGFIDKIAENVEEVKRKHSAILASPNPDEKTKEELEELMSDIKKTANKVRSKLKSIEQSIEQEEGLNRSSADLRIRKTQHSTLSRKFVEVMSEYNATQSDYRERCKGRIQRQLEITGRTTTSEELEDMLESGNPAIFASGIIMDSSISKQALSEIETRHSEIIKLETSIRELHDMFMDMAMLVESQGEMIDRIEYNVEHAVDYVERAVSDTKKAVKYQSKARRKKIMIIICCVILGIIIASTIGGIFG |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | Stx1a |
Synonyms | Stx1a; Syntaxin-1A; Neuron-specific antigen HPC-1 |
UniProt ID | O35526 |
◆ Recombinant Proteins | ||
STX1A-5811R | Recombinant Rat STX1A Protein | +Inquiry |
RFL36193MF | Recombinant Full Length Mouse Syntaxin-1A(Stx1A) Protein, His-Tagged | +Inquiry |
STX1A-2988H | Recombinant Human STX1A Protein, MYC/DDK-tagged | +Inquiry |
Stx1a-6205M | Recombinant Mouse Stx1a Protein, Myc/DDK-tagged | +Inquiry |
STX1A-16187M | Recombinant Mouse STX1A Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
STX1A-1717HCL | Recombinant Human STX1A cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Stx1a Products
Required fields are marked with *
My Review for All Stx1a Products
Required fields are marked with *
0
Inquiry Basket