Recombinant Full Length Mouse T-Cell Surface Glycoprotein Cd3 Delta Chain(Cd3D) Protein, His-Tagged
Cat.No. : | RFL6965MF |
Product Overview : | Recombinant Full Length Mouse T-cell surface glycoprotein CD3 delta chain(Cd3d) Protein (P04235) (22-173aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mus musculus |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length of Mature Protein (22-173) |
Form : | Lyophilized powder |
AA Sequence : | FKIQVTEYEDKVFVTCNTSVMHLDGTVEGWFAKNKTLNLGKGVLDPRGIYLCNGTEQLAKVVSSVQVHYRMCQNCVELDSGTMAGVIFIDLIATLLLALGVYCFAGHETGRPSGAAEVQALLKNEQLYQPLRDREDTQYSRLGGNWPRNKKS |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | Cd3d |
Synonyms | Cd3d; T3d; T-cell surface glycoprotein CD3 delta chain; T-cell receptor T3 delta chain; CD antigen CD3d |
UniProt ID | P04235 |
◆ Recombinant Proteins | ||
Cd3d-1906R | Recombinant Rat Cd3d protein, His-tagged | +Inquiry |
Cd3d-1903M | Recombinant Mouse Cd3d protein, His-tagged | +Inquiry |
CD3D-1458H | Recombinant Human CD3D Protein (Phe22-Ala105), N-His tagged | +Inquiry |
CD3D-1182C | Recombinant Cynomolgus CD3D protein, hFc-tagged | +Inquiry |
CD3D-1056C | Recombinant Canine CD3D Protein, Fc-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CD3D-1381MCL | Recombinant Mouse CD3D cell lysate | +Inquiry |
CD3D-1274HCL | Recombinant Human CD3D cell lysate | +Inquiry |
CD3D-1466CCL | Recombinant Cynomolgus CD3D cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Cd3d Products
Required fields are marked with *
My Review for All Cd3d Products
Required fields are marked with *