Recombinant Full Length Mouse Tumor Necrosis Factor Receptor Superfamily Member 9(Tnfrsf9) Protein, His-Tagged
Cat.No. : | RFL2231MF |
Product Overview : | Recombinant Full Length Mouse Tumor necrosis factor receptor superfamily member 9(Tnfrsf9) Protein (P20334) (24-256aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mus musculus |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length of Mature Protein (24-256) |
Form : | Lyophilized powder |
AA Sequence : | VQNSCDNCQPGTFCRKYNPVCKSCPPSTFSSIGGQPNCNICRVCAGYFRFKKFCSSTHNAECECIEGFHCLGPQCTRCEKDCRPGQELTKQGCKTCSLGTFNDQNGTGVCRPWTNCSLDGRSVLKTGTTEKDVVCGPPVVSFSPSTTISVTPEGGPGGHSLQVLTLFLALTSALLLALIFITLLFSVLKWIRKKFPHIFKQPFKKTTGAAQEEDACSCRCPQEEEGGGGGYEL |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | Tnfrsf9 |
Synonyms | Tnfrsf9; Cd137; Ila; Ly63; Tumor necrosis factor receptor superfamily member 9; 4-1BB ligand receptor; T-cell antigen 4-1BB; CD antigen CD137 |
UniProt ID | P20334 |
◆ Recombinant Proteins | ||
TNFRSF9-1025C | Recombinant Cynomolgus TNFRSF9 protein, His-tagged | +Inquiry |
TNFRSF9-581HAF555 | Recombinant Human TNFRSF9 Protein, Fc/His-tagged, Alexa Fluor 555 conjugated | +Inquiry |
TNFRSF9-39H | Recombinant Human TNFRSF9 Protein, hIgG-His-tagged | +Inquiry |
Tnfrsf9-635MAF555 | Recombinant Mouse Tnfrsf9 Protein, Fc-tagged, Alexa Fluor 555 conjugated | +Inquiry |
TNFRSF9-579C | Recombinant Cynomolgus monkey TNFRSF9 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
TNFRSF9-928CCL | Recombinant Canine TNFRSF9 cell lysate | +Inquiry |
TNFRSF9-2162HCL | Recombinant Human TNFRSF9 cell lysate | +Inquiry |
TNFRSF9-1792MCL | Recombinant Mouse TNFRSF9 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Tnfrsf9 Products
Required fields are marked with *
My Review for All Tnfrsf9 Products
Required fields are marked with *
0
Inquiry Basket