Recombinant Full Length Mouse Tumor Necrosis Factor Receptor Superfamily Member 9(Tnfrsf9) Protein, His-Tagged
| Cat.No. : | RFL2231MF |
| Product Overview : | Recombinant Full Length Mouse Tumor necrosis factor receptor superfamily member 9(Tnfrsf9) Protein (P20334) (24-256aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Mouse |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | Full Length of Mature Protein (24-256) |
| Form : | Lyophilized powder |
| AA Sequence : | VQNSCDNCQPGTFCRKYNPVCKSCPPSTFSSIGGQPNCNICRVCAGYFRFKKFCSSTHNAECECIEGFHCLGPQCTRCEKDCRPGQELTKQGCKTCSLGTFNDQNGTGVCRPWTNCSLDGRSVLKTGTTEKDVVCGPPVVSFSPSTTISVTPEGGPGGHSLQVLTLFLALTSALLLALIFITLLFSVLKWIRKKFPHIFKQPFKKTTGAAQEEDACSCRCPQEEEGGGGGYEL |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Applications : | SDS-PAGE |
| Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
| Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
| Gene Name | Tnfrsf9 |
| Synonyms | Tnfrsf9; Cd137; Ila; Ly63; Tumor necrosis factor receptor superfamily member 9; 4-1BB ligand receptor; T-cell antigen 4-1BB; CD antigen CD137 |
| UniProt ID | P20334 |
| ◆ Recombinant Proteins | ||
| TNFRSF9-1108H | Recombinant Human TNFRSF9 protein(Met1-Leu152), His-tagged | +Inquiry |
| TNFRSF9-212H | Recombinant Human TNFRSF9 Protein, DYKDDDDK-tagged | +Inquiry |
| TNFRSF9-580H | Recombinant Human TNFRSF9 Protein | +Inquiry |
| TNFRSF9-315H | Recombinant Human TNFRSF9 Protein (ECD), Fc-His-tagged(C-ter) | +Inquiry |
| TNFRSF9-191C | Active Recombinant Cynomolgus TNFRSF9 protein, hFc-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| TNFRSF9-928CCL | Recombinant Canine TNFRSF9 cell lysate | +Inquiry |
| TNFRSF9-2162HCL | Recombinant Human TNFRSF9 cell lysate | +Inquiry |
| TNFRSF9-1792MCL | Recombinant Mouse TNFRSF9 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Tnfrsf9 Products
Required fields are marked with *
My Review for All Tnfrsf9 Products
Required fields are marked with *
