Recombinant Full Length Mouse Tyro Protein Tyrosine Kinase-Binding Protein(Tyrobp) Protein, His-Tagged
| Cat.No. : | RFL1735MF |
| Product Overview : | Recombinant Full Length Mouse TYRO protein tyrosine kinase-binding protein(Tyrobp) Protein (O54885) (22-114aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Mus musculus |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | Full Length of Mature Protein (22-114) |
| Form : | Lyophilized powder |
| AA Sequence : | LSPVQAQSDTFPRCDCSSVSPGVLAGIVLGDLVLTLLIALAVYSLGRLVSRGQGTAEGTRKQHIAETESPYQELQGQRPEVYSDLNTQRQYYR |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Applications : | SDS-PAGE |
| Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
| Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
| Gene Name | Tyrobp |
| Synonyms | Tyrobp; Dap12; Karap; TYRO protein tyrosine kinase-binding protein; DNAX-activation protein 12; Killer-activating receptor-associated protein; KAR-associated protein |
| UniProt ID | O54885 |
| ◆ Recombinant Proteins | ||
| TYROBP-4167H | Recombinant Human TYROBP Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| TYROBP-2287H | Recombinant Human TYROBP Protein, His (Fc)-Avi-tagged | +Inquiry |
| TYROBP-5044R | Recombinant Rhesus monkey TYROBP Protein, His-tagged | +Inquiry |
| Tyrobp-6759M | Recombinant Mouse Tyrobp Protein, Myc/DDK-tagged | +Inquiry |
| TYROBP-6383R | Recombinant Rat TYROBP Protein | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| TYROBP-614HCL | Recombinant Human TYROBP 293 Cell Lysate | +Inquiry |
| TYROBP-613HCL | Recombinant Human TYROBP 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Tyrobp Products
Required fields are marked with *
My Review for All Tyrobp Products
Required fields are marked with *
