Recombinant Full Length Pan Troglodytes Sperm Acrosome Membrane-Associated Protein 3(Spaca3) Protein, His-Tagged
| Cat.No. : | RFL14322PF |
| Product Overview : | Recombinant Full Length Pan troglodytes Sperm acrosome membrane-associated protein 3(SPACA3) Protein (B6VH76) (1-215aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Pan troglodytes |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | Full Length (1-215) |
| Form : | Lyophilized powder |
| AA Sequence : | MVSALRRAPLIRVHSSPVSSPSVSGPQRLVSCLSSQSSALSQSGGGSTSAAGIEARSRALRRRWCPAGIMLLALVCLLSCLLPSSEAKLYGRCELARVLHDFGLDGYRGYSLADWVCLAYFTSGFNAAALDYEADGSTNNGIFQINSRRWCSNLTPNVPNVCQMYCSDLLNPNLKDTVICAMKITQEPQGLGYWEAWRHHCQGKDLTEWVDGCDF |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Applications : | SDS-PAGE |
| Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
| Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
| Gene Name | SPACA3 |
| Synonyms | SPACA3; SPRASA; Sperm acrosome membrane-associated protein 3; Sperm protein reactive with antisperm antibodies; Sperm protein reactive with ASA |
| UniProt ID | B6VH76 |
| ◆ Recombinant Proteins | ||
| SPACA3-2892H | Recombinant Human SPACA3 protein, His-tagged | +Inquiry |
| SPACA3-15803M | Recombinant Mouse SPACA3 Protein | +Inquiry |
| SPACA3-2891H | Recombinant Human SPACA3, GST-tagged | +Inquiry |
| SPACA3-8600M | Recombinant Mouse SPACA3 Protein, His (Fc)-Avi-tagged | +Inquiry |
| Spaca3-6065M | Recombinant Mouse Spaca3 Protein, Myc/DDK-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| SPACA3-1678HCL | Recombinant Human SPACA3 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SPACA3 Products
Required fields are marked with *
My Review for All SPACA3 Products
Required fields are marked with *
