Recombinant Full Length Pig 5-Hydroxytryptamine Receptor 1E(Htr1E) Protein, His-Tagged
Cat.No. : | RFL10440SF |
Product Overview : | Recombinant Full Length Pig 5-hydroxytryptamine receptor 1E(HTR1E) Protein (Q29003) (1-149aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Sus scrofa (Pig) |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length (1-149) |
Form : | Lyophilized powder |
AA Sequence : | HQPANYLICSLAVTDLLVAVLVMPLSIMYIVMDSWRLGYFICEVWLSVDMTCCTCSILHL CVIALDRYWAITNAIEYARKRTAKRAGLMILTVWTISIFISMPPLFWRSHRQLSPPPSQC AIQHDHVIYTIYSTLGAFYIPLTLILILY |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | HTR1E |
Synonyms | HTR1E; 5-hydroxytryptamine receptor 1E; 5-HT-1E; 5-HT1E; Serotonin receptor 1E; Fragment |
UniProt ID | Q29003 |
◆ Recombinant Proteins | ||
RFL27491PF | Recombinant Full Length Pan Troglodytes 5-Hydroxytryptamine Receptor 1E(Htr1E) Protein, His-Tagged | +Inquiry |
HTR1E-5247H | Recombinant Human HTR1E Protein, GST-tagged | +Inquiry |
HTR1E-1089HFL | Recombinant Human HTR1E protein, His&Flag-tagged | +Inquiry |
HTR1E-5248H | Recombinant Human HTR1E Protein | +Inquiry |
HTR1E-5678HF | Recombinant Full Length Human HTR1E Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
HTR1E-5336HCL | Recombinant Human HTR1E 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All HTR1E Products
Required fields are marked with *
My Review for All HTR1E Products
Required fields are marked with *