Recombinant Full Length Pig Leukocyte Surface Antigen Cd47(Cd47) Protein, His-Tagged
Cat.No. : | RFL17555SF |
Product Overview : | Recombinant Full Length Pig Leukocyte surface antigen CD47(CD47) Protein (Q9GKE8) (19-303aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Sus scrofa (Pig) |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length of Mature Protein (19-303) |
Form : | Lyophilized powder |
AA Sequence : | QLIFNITKSVEFTVCNTTVTIPCFVNNMEAKNISELYVKWKFKGKDIFIFDGAQHISKPS EAFPSSKISPSELLHGIASLKMDKRDAVIGNYTCEVTELSREGETIIELKRRFVSWFSPN ENILIVIFPILAILLFWGQFGILTLKYKSSYTKEKTIFLLVAGLMLTIIVIVGAILFIPG EYSTKNACGLGLIVIPTAILILLQYCVFMMALGMSSFTIAILILQVLGHVLSVVGLSLCV SECTPVHGPLLISGLGIIALAELLGLVYMKCVASDHKTIQPPRNN |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | CD47 |
Synonyms | CD47; Leukocyte surface antigen CD47; Integrin-associated protein; IAP; CD antigen CD47 |
UniProt ID | Q9GKE8 |
◆ Recombinant Proteins | ||
Cd47-8767RF | Recombinant Rat Cd47 Protein, His-tagged, FITC conjugated | +Inquiry |
CD47-1255R | Recombinant Rat CD47 Protein | +Inquiry |
CD47-333H | Recombinant CD47 protein, His/Avi-tagged | +Inquiry |
Cd47-647M | Recombinant Mouse Cd47 protein, His-tagged | +Inquiry |
Cd47-7480R | Recombinant Rat Cd47 protein, Fc-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CD47-850HCL | Recombinant Human CD47 cell lysate | +Inquiry |
CD47-1363RCL | Recombinant Rat CD47 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CD47 Products
Required fields are marked with *
My Review for All CD47 Products
Required fields are marked with *
0
Inquiry Basket