Recombinant Full Length Pongo Abelii 1-Acyl-Sn-Glycerol-3-Phosphate Acyltransferase Delta(Agpat4) Protein, His-Tagged
| Cat.No. : | RFL4925PF |
| Product Overview : | Recombinant Full Length Pongo abelii 1-acyl-sn-glycerol-3-phosphate acyltransferase delta(AGPAT4) Protein (Q5R757) (1-378aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Pongo Abelii |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | Full Length (1-378) |
| Form : | Lyophilized powder |
| AA Sequence : | MDLAGLLKSQFLCHLVFCYVFIASGLIINTIQLFTLLLWPINKQLFRKINCRLSYCISSQ LVMLLEWWSGTECTIFTDPRAYLKYGKENAIVVLNHKFEIDFLCGWSLSERFGLLGGSKV LAKKELAYVPIIGWMWYFTEMVFCSRKWEQDRKTVATSLQHLRDYPEKYFFLIHCEGTRF TEKKHEISMQVARAKGLPRLKHHLLPRTKGFAITVRSLRNVVSAVYDCTLNFRNNENPTL LGVLNGKKYHADLYVRRIPLEDIPEDDDECSAWLHKLYQEKDAFQEEYYRTGTFPETPMV PPRRPWTLVNWLFWASLVLYPFFQFLVSMIRSGSSLTLASFILVFFVASVGVRWMIGVTE IDKGSAYGNSGSKQKLND |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
| Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
| Gene Name | AGPAT4 |
| Synonyms | AGPAT4; 1-acyl-sn-glycerol-3-phosphate acyltransferase delta; 1-acylglycerol-3-phosphate O-acyltransferase 4; 1-AGP acyltransferase 4; 1-AGPAT 4; Lysophosphatidic acid acyltransferase delta; LPAAT-delta |
| UniProt ID | Q5R757 |
| ◆ Recombinant Proteins | ||
| AGPAT4-1048H | Recombinant Human AGPAT4 Full Length Transmembrane protein, His-tagged | +Inquiry |
| AGPAT4-12236Z | Recombinant Zebrafish AGPAT4 | +Inquiry |
| RFL4925PF | Recombinant Full Length Pongo Abelii 1-Acyl-Sn-Glycerol-3-Phosphate Acyltransferase Delta(Agpat4) Protein, His-Tagged | +Inquiry |
| AGPAT4-1420M | Recombinant Mouse AGPAT4 Protein | +Inquiry |
| AGPAT4-932HF | Recombinant Full Length Human AGPAT4 Protein, GST-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| AGPAT4-8975HCL | Recombinant Human AGPAT4 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All AGPAT4 Products
Required fields are marked with *
My Review for All AGPAT4 Products
Required fields are marked with *
