Recombinant Full Length Pongo Abelii Cytochrome B5 Type B(Cyb5B) Protein, His-Tagged

• Cat.No.: RFL34012PF
• Product Overview: Recombinant Full Length Pongo abelii Cytochrome b5 type B(CYB5B) Protein (Q5RDJ5) (12-146aa), fused to N-terminal His tag, was expressed in E. coli.

Specification

• Species: Pongo Abelii
• Source: E.coli
• Tag: His
• Protein Length: Full Length of Mature Protein (12-146)
• Form: Lyophilized powder
• AA Sequence: KGQEVETSVTYYRMEEVAKRNSLKELWLVIHGRVYDVTRFLNEHPGGEEVLLEQAGVDASESFEDVGHSSDAREMLKQYYIGDIHPSDLKPENGSKDPSKNDTCKSCWAYWILPIIGAVLLGFLYRYYTPESKSS
• Purity: Greater than 90% as determined by SDS-PAGE.
• Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Storage Buffer: Tris/PBS-based buffer, 6% Trehalose, pH 8.0
• Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Gene Information

• Gene Name: CYB5B
• Synonyms: CYB5B; CYB5M; Cytochrome b5 type B; Cytochrome b5 outer mitochondrial membrane isoform
• UniProt ID: Q5RDJ5

Q&As

Is there an iron or heme content for this particular product?

The culture medium contains trace elements such as iron (Fe). In theory, these elements should be incorporated into the structure. However, this has not been experimentally verified on the final product.