Recombinant Human CYB5B protein, His-tagged
| Cat.No. : | CYB5B-3621H |
| Product Overview : | Recombinant Human CYB5B protein(1-110 aa), fused with N-terminal His tag, was expressed in E.coli. |
| Availability | January 14, 2026 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 1-110 aa |
| Form : | The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 7.4). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. The protein was eluted with a buffer containing 300 mM imidazole. |
| AASequence : | MATAEASGSDGKGQEVETSVTYYRLEEVAKRNSLKELWLVIHGRVYDVTRFLNEHPGGEEVLLEQAGVDASESFEDVGHSSDAREMLKQYYIGDIHPSDLKPESGSKDPS |
| Purity : | 90%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution. |
| Gene Name | CYB5B cytochrome b5 type B (outer mitochondrial membrane) [ Homo sapiens ] |
| Official Symbol | CYB5B |
| Synonyms | CYB5B; cytochrome b5 type B (outer mitochondrial membrane); cytochrome b5 type B; CYB5 M; type 2 cyt-b5; outer mitochondrial membrane cytochrome b5; cytochrome b5 outer mitochondrial membrane isoform; OMB5; CYB5-M; CYPB5M; DKFZp686M0619; |
| Gene ID | 80777 |
| mRNA Refseq | NM_030579 |
| Protein Refseq | NP_085056 |
| MIM | 611964 |
| UniProt ID | O43169 |
| ◆ Recombinant Proteins | ||
| CYB5B-03HFL | Recombinant Human CYB5B Protein (Full Length), C-Myc/DDK tagged | +Inquiry |
| CYB5B-3621H | Recombinant Human CYB5B protein, His-tagged | +Inquiry |
| RFL22458RF | Recombinant Full Length Rat Cytochrome B5 Type B(Cyb5B) Protein, His-Tagged | +Inquiry |
| CYB5B-4656H | Recombinant Human CYB5B protein, His-tagged | +Inquiry |
| CYB5B-4122M | Recombinant Mouse Cyb5b Protein, C-Myc/DDK tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| CYB5B-7145HCL | Recombinant Human CYB5B 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (1)
Ask a Question for All CYB5B Products
Required fields are marked with *
My Review for All CYB5B Products
Required fields are marked with *