Recombinant Human CYB5B protein, His-tagged
Cat.No. : | CYB5B-3621H |
Product Overview : | Recombinant Human CYB5B protein(1-110 aa), fused with N-terminal His tag, was expressed in E.coli. |
Availability | August 21, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 1-110 aa |
Form : | The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 7.4). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. The protein was eluted with a buffer containing 300 mM imidazole. |
AASequence : | MATAEASGSDGKGQEVETSVTYYRLEEVAKRNSLKELWLVIHGRVYDVTRFLNEHPGGEEVLLEQAGVDASESFEDVGHSSDAREMLKQYYIGDIHPSDLKPESGSKDPS |
Purity : | 90%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution. |
Gene Name | CYB5B cytochrome b5 type B (outer mitochondrial membrane) [ Homo sapiens ] |
Official Symbol | CYB5B |
Synonyms | CYB5B; cytochrome b5 type B (outer mitochondrial membrane); cytochrome b5 type B; CYB5 M; type 2 cyt-b5; outer mitochondrial membrane cytochrome b5; cytochrome b5 outer mitochondrial membrane isoform; OMB5; CYB5-M; CYPB5M; DKFZp686M0619; |
Gene ID | 80777 |
mRNA Refseq | NM_030579 |
Protein Refseq | NP_085056 |
MIM | 611964 |
UniProt ID | O43169 |
◆ Recombinant Proteins | ||
CYB5B-1701R | Recombinant Rat CYB5B Protein | +Inquiry |
CYB5B-948R | Recombinant Rhesus Macaque CYB5B Protein, His (Fc)-Avi-tagged | +Inquiry |
CYB5B-12135Z | Recombinant Zebrafish CYB5B | +Inquiry |
RFL3123MF | Recombinant Full Length Mouse Cytochrome B5 Type B(Cyb5B) Protein, His-Tagged | +Inquiry |
RFL22458RF | Recombinant Full Length Rat Cytochrome B5 Type B(Cyb5B) Protein, His-Tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CYB5B-7145HCL | Recombinant Human CYB5B 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (1)
Ask a Question for All CYB5B Products
Required fields are marked with *
My Review for All CYB5B Products
Required fields are marked with *