Recombinant Human CYB5B protein, GST-tagged
Cat.No. : | CYB5B-11745H |
Product Overview : | Recombinant Human CYB5B protein(1-110 aa), fused with GST tag, was expressed in E.coli. |
Availability | June 30, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | 1-110 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 100mM GSH. |
AA Sequence : | MATAEASGSDGKGQEVETSVTYYRLEEVAKRNSLKELWLVIHGRVYDVTRFLNEHPGGEEVLLEQAGVDASESFEDVGHSSDAREMLKQYYIGDIHPSDLKPESGSKDPS |
Purity : | 90%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | CYB5B cytochrome b5 type B (outer mitochondrial membrane) [ Homo sapiens ] |
Official Symbol | CYB5B |
Synonyms | CYB5B; cytochrome b5 type B (outer mitochondrial membrane); cytochrome b5 type B; CYB5 M; type 2 cyt-b5; outer mitochondrial membrane cytochrome b5; cytochrome b5 outer mitochondrial membrane isoform; OMB5; CYB5-M; CYPB5M; DKFZp686M0619; |
Gene ID | 80777 |
mRNA Refseq | NM_030579 |
Protein Refseq | NP_085056 |
MIM | 611964 |
UniProt ID | O43169 |
◆ Recombinant Proteins | ||
RFL22458RF | Recombinant Full Length Rat Cytochrome B5 Type B(Cyb5B) Protein, His-Tagged | +Inquiry |
CYB5B-2109M | Recombinant Mouse CYB5B Protein, His (Fc)-Avi-tagged | +Inquiry |
CYB5B-948R | Recombinant Rhesus Macaque CYB5B Protein, His (Fc)-Avi-tagged | +Inquiry |
CYB5B-1701R | Recombinant Rat CYB5B Protein | +Inquiry |
CYB5B-1123R | Recombinant Rhesus monkey CYB5B Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CYB5B-7145HCL | Recombinant Human CYB5B 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (1)
Ask a Question for All CYB5B Products
Required fields are marked with *
My Review for All CYB5B Products
Required fields are marked with *