Recombinant Full Length Pongo Abelii Solute Carrier Family 22 Member 24(Slc22A24) Protein, His-Tagged
Cat.No. : | RFL14541PF |
Product Overview : | Recombinant Full Length Pongo abelii Solute carrier family 22 member 24(SLC22A24) Protein (Q5RC45) (1-330aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Pongo Abelii |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length (1-330) |
Form : | Lyophilized powder |
AA Sequence : | MGFDVLLDQVGGMGRFQICLIAFFCIANILLFPNIVLENFTAFTPGHRCWVPLLDNDTVS DNDTGTLSKDDLLRISIPLDSNLRPQKCQRFIHPQWQLLHLKGTFPNTNETDTEPCVDGW VYDRTSFLSTIVTEWDLVCESQSLKSMVQSLFMAGSLLGGLIYGHLSDRVGRKIICKLCF LQLAISNTCAAFAPTFLVYCILRFLAGFSTMTILGNTFILSLEWTLPQSRSMAIMVLLCS YSVGQMLLGGLAFAIQDWRVLQLTVSTPIIVLFLSSWKMVESARWLIINNQLDEGLKELR RVAHTNGKKNTEETLTAEVIWKGEMIAVIK |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | SLC22A24 |
Synonyms | SLC22A24; Steroid transmembrane transporter SLC22A24; Solute carrier family 22 member 24 |
UniProt ID | Q5RC45 |
◆ Recombinant Proteins | ||
SLC22A24-943H | Recombinant Human SLC22A24 | +Inquiry |
SLC22A24-4069H | Recombinant Human SLC22A24 Protein, His (Fc)-Avi-tagged | +Inquiry |
RFL10749HF | Recombinant Full Length Human Solute Carrier Family 22 Member 24(Slc22A24) Protein, His-Tagged | +Inquiry |
SLC22A24-5274H | Recombinant Human SLC22A24 Protein, GST-tagged | +Inquiry |
SLC22A24-2711H | Recombinant Human SLC22A24, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
SLC22A24-1100HCL | Recombinant Human SLC22A24 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SLC22A24 Products
Required fields are marked with *
My Review for All SLC22A24 Products
Required fields are marked with *