Recombinant Human SLC22A24 Protein, GST-tagged
Cat.No. : | SLC22A24-5274H |
Product Overview : | Human MGC34821 full-length ORF ( NP_775857.1, 1 a.a. - 322 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | SLC22A24 belongs to a large family of transmembrane proteins that function as uniporters, symporters, and antiporters to transport organic ions across cell membranes (Jacobsson et al., 2007 [PubMed 17714910]).[supplied by OMIM |
Molecular Mass : | 62.3 kDa |
AA Sequence : | MGFDVLLDQVGGMGRFQICLIAFFCITNILLFPNIVLENFTAFTPSHRCWVPLLDNDSVSDNDTGTLSKDDLLRISIPLDSNLRPQKCQRFIHPQWQLLHLNGTFPNTNEPDTEPCVDGWVYDRSSFLSTIVTEWDLVCESQSLKSMVQSLFMAGSLLGGLIYGHLSDRVGRKIICKLCFLQLAISNTCAAFAPTFLVYCILRFLAGFSTMTILGNTFILSLEWTLPRSRSMTIMVLLCSYSVGQMLLGGLAFAIQDWHILQLTVSTPIIVLFLSSWYEQSPHSLPVSEAMVDIERKIVTPGICSVSGLVLSHDVHSTYCVT |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | SLC22A24 solute carrier family 22 member 24 [ Homo sapiens (human) ] |
Official Symbol | SLC22A24 |
Synonyms | SLC22A24; solute carrier family 22 member 24; NET46; solute carrier family 22 member 24 |
Gene ID | 283238 |
mRNA Refseq | NM_001136506 |
Protein Refseq | NP_001129978 |
MIM | 611698 |
UniProt ID | Q8N4F4 |
◆ Recombinant Proteins | ||
RFL14541PF | Recombinant Full Length Pongo Abelii Solute Carrier Family 22 Member 24(Slc22A24) Protein, His-Tagged | +Inquiry |
SLC22A24-5274H | Recombinant Human SLC22A24 Protein, GST-tagged | +Inquiry |
SLC22A24-6401HF | Recombinant Full Length Human SLC22A24 Protein, GST-tagged | +Inquiry |
SLC22A24-2711H | Recombinant Human SLC22A24, His-tagged | +Inquiry |
RFL10749HF | Recombinant Full Length Human Solute Carrier Family 22 Member 24(Slc22A24) Protein, His-Tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
SLC22A24-1100HCL | Recombinant Human SLC22A24 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SLC22A24 Products
Required fields are marked with *
My Review for All SLC22A24 Products
Required fields are marked with *