Recombinant Human SLC22A24 Protein, GST-tagged

• Cat.No.: SLC22A24-5274H
• Product Overview: Human MGC34821 full-length ORF ( NP_775857.1, 1 a.a. - 322 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: SLC22A24 belongs to a large family of transmembrane proteins that function as uniporters, symporters, and antiporters to transport organic ions across cell membranes (Jacobsson et al., 2007 [PubMed 17714910]).[supplied by OMIM
• Molecular Mass: 62.3 kDa
• AA Sequence: MGFDVLLDQVGGMGRFQICLIAFFCITNILLFPNIVLENFTAFTPSHRCWVPLLDNDSVSDNDTGTLSKDDLLRISIPLDSNLRPQKCQRFIHPQWQLLHLNGTFPNTNEPDTEPCVDGWVYDRSSFLSTIVTEWDLVCESQSLKSMVQSLFMAGSLLGGLIYGHLSDRVGRKIICKLCFLQLAISNTCAAFAPTFLVYCILRFLAGFSTMTILGNTFILSLEWTLPRSRSMTIMVLLCSYSVGQMLLGGLAFAIQDWHILQLTVSTPIIVLFLSSWYEQSPHSLPVSEAMVDIERKIVTPGICSVSGLVLSHDVHSTYCVT
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: SLC22A24 solute carrier family 22 member 24 [ Homo sapiens (human) ]
• Official Symbol: SLC22A24
• Synonyms: SLC22A24; solute carrier family 22 member 24; NET46; solute carrier family 22 member 24
• Gene ID: 283238
• mRNA Refseq: NM_001136506
• Protein Refseq: NP_001129978
• MIM: 611698
• UniProt ID: Q8N4F4