Recombinant Full Length Rat 3 Beta-Hydroxysteroid Dehydrogenase Type 7(Hsd3B7) Protein, His-Tagged
| Cat.No. : | RFL16774RF |
| Product Overview : | Recombinant Full Length Rat 3 beta-hydroxysteroid dehydrogenase type 7(Hsd3b7) Protein (O35048) (1-338aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Rat |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | Full Length (1-338) |
| Form : | Lyophilized powder |
| AA Sequence : | MADSAQVPALVYLVTGGCGFLGEHIVRMLLEWEPRLRELRVFDLHLSSWLEELKTGPVQV TAIQGDVTQAHEVAAAMAGSHVVIHTAGLVDVFGKASPETIHKVNVQGTQNVIDACVQTG TRLLVYTSSMEVVGPNVKGHPFYRGNEDTPYEAIHRHPYPCSKALAEQLVLEANGRKGLR FGGRLFRAIPASVEHGRVYVGNVAWMHILVARELEQRAALMGGQVYFCYDKSPYKSYEDF NMEFLSPCGLRLIGTHPLLPYWLLVLLTALNALLQWLLRPLVLYTPLLNPYTLAVANTTF TVSTNKAQRHFGYKPLFSWEESRARTIHWVQAMEGSAW |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Applications : | SDS-PAGE |
| Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
| Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
| Gene Name | Hsd3b7 |
| Synonyms | Hsd3b7; Cca2; 3 beta-hydroxysteroid dehydrogenase type 7; 3 beta-hydroxysteroid dehydrogenase type VII; 3-beta-HSD VII; 3-beta-hydroxy-Delta(5-C27 steroid oxidoreductase; C(27 3-beta-HSD; Cholest-5-ene-3-beta,7-alpha-diol 3-beta-dehydrogenase; Confluent 3 |
| UniProt ID | O35048 |
| ◆ Recombinant Proteins | ||
| HSD3B7-5081H | Recombinant Human HSD3B7 Protein, GST-tagged | +Inquiry |
| HSD3B7-13966H | Recombinant Human HSD3B7 protein, GST-tagged | +Inquiry |
| RFL24836HF | Recombinant Full Length Human 3 Beta-Hydroxysteroid Dehydrogenase Type 7(Hsd3B7) Protein, His-Tagged | +Inquiry |
| RFL16774RF | Recombinant Full Length Rat 3 Beta-Hydroxysteroid Dehydrogenase Type 7(Hsd3B7) Protein, His-Tagged | +Inquiry |
| HSD3B7-2936R | Recombinant Rat HSD3B7 Protein | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| HSD3B7-5368HCL | Recombinant Human HSD3B7 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Hsd3b7 Products
Required fields are marked with *
My Review for All Hsd3b7 Products
Required fields are marked with *
