Recombinant Full Length Rat Atp-Sensitive Inward Rectifier Potassium Channel 1(Kcnj1) Protein, His-Tagged
Cat.No. : | RFL30716RF |
Product Overview : | Recombinant Full Length Rat ATP-sensitive inward rectifier potassium channel 1(Kcnj1) Protein (P35560) (1-391aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Rat |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length (1-391) |
Form : | Lyophilized powder |
AA Sequence : | MGASERSVFRVLIRALTERMFKHLRRWFITHIFGRSRQRARLVSKEGRCNIEFGNVDAQS RFIFFVDIWTTVLDLKWRYKMTVFITAFLGSWFLFGLLWYVVAYVHKDLPEFYPPDNRTP CVENINGMTSAFLFSLETQVTIGYGFRFVTEQCATAIFLLIFQSILGVIINSFMCGAILA KISRPKKRAKTITFSKNAVISKRGGKLCLLIRVANLRKSLLIGSHIYGKLLKTTITPEGE TIILDQTNINFVVDAGNENLFFISPLTIYHIIDHNSPFFHMAAETLSQQDFELVVFLDGT VESTSATCQVRTSYVPEEVLWGYRFVPIVSKTKEGKYRVDFHNFGKTVEVETPHCAMCLY NEKDARARMKRGYDNPNFVLSEVDETDDTQM |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | Kcnj1 |
Synonyms | Kcnj1; Romk1; ATP-sensitive inward rectifier potassium channel 1; ATP-regulated potassium channel ROM-K; Inward rectifier K(+ channel Kir1.1; KAB-1; Potassium channel, inwardly rectifying subfamily J member 1 |
UniProt ID | P35560 |
◆ Recombinant Proteins | ||
KCNJ1-3194R | Recombinant Rat KCNJ1 Protein | +Inquiry |
RFL30716RF | Recombinant Full Length Rat Atp-Sensitive Inward Rectifier Potassium Channel 1(Kcnj1) Protein, His-Tagged | +Inquiry |
KCNJ1-28453TH | Recombinant Human KCNJ1 | +Inquiry |
KCNJ1-1431H | Recombinant Human KCNJ1 Protein (178-391 aa), His-tagged | +Inquiry |
Kcnj1-3754M | Recombinant Mouse Kcnj1, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
KCNJ1-5049HCL | Recombinant Human KCNJ1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Kcnj1 Products
Required fields are marked with *
My Review for All Kcnj1 Products
Required fields are marked with *