Recombinant Full Length Rat Beta-Galactoside Alpha-2,6-Sialyltransferase 1(St6Gal1) Protein, His-Tagged
Cat.No. : | RFL6513RF |
Product Overview : | Recombinant Full Length Rat Beta-galactoside alpha-2,6-sialyltransferase 1(St6gal1) Protein (P13721) (1-403aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Rat |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length (1-403) |
Form : | Lyophilized powder |
AA Sequence : | MIHTNLKKKFSLFILVFLLFAVICVWKKGSDYEALTLQAKEFQMPKSQEKVAMGSASQVVFSNSKQDPKEDIPILSYHRVTAKVKPQPSFQVWDKDSTYSKLNPRLLKIWRNYLNMNKYKVSYKGPGPGVKFSVEALRCHLRDHVNVSMIEATDFPFNTTEWEGYLPKENFRTKVGPWQRCAVVSSAGSLKNSQLGREIDNHDAVLRFNGAPTDNFQQDVGSKTTIRLMNSQLVTTEKRFLKDSLYTEGILIVWDPSVYHADIPKWYQKPDYNFFETYKSYRRLNPSQPFYILKPQMPWELWDIIQEISADLIQPNPPSSGMLGIIIMMTLCDQVDIYEFLPSKRKTDVCYYHQKFFDSACTMGAYDPLLFEKNMVKHLNEGTDEDIYLFGKATLSGFRNIRC |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | St6gal1 |
Synonyms | St6gal1; Siat1; Beta-galactoside alpha-2,6-sialyltransferase 1; Alpha 2,6-ST 1; CMP-N-acetylneuraminate-beta-galactosamide-alpha-2,6-sialyltransferase 1; ST6Gal I; ST6GalI; Sialyltransferase 1 |
UniProt ID | P13721 |
◆ Recombinant Proteins | ||
ST6GAL1-28H | Active Recombinant Human ST6GAL1 Protein | +Inquiry |
ST6GAL1-2739H | Recombinant Human ST6GAL1 Protein, His-tagged | +Inquiry |
ST6GAL1-4501R | Recombinant Rhesus monkey ST6GAL1 Protein, His-tagged | +Inquiry |
ST6GAL1-58H | Recombinant Human ST6GAL1 protein, His-tagged | +Inquiry |
ST6GAL1-4147H | Recombinant Human ST6GAL1 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ST6GAL1-1919HCL | Recombinant Human ST6GAL1 cell lysate | +Inquiry |
ST6GAL1-1760MCL | Recombinant Mouse ST6GAL1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All St6gal1 Products
Required fields are marked with *
My Review for All St6gal1 Products
Required fields are marked with *