Recombinant Full Length Rat Cell Cycle Control Protein 50A(Tmem30A) Protein, His-Tagged
Cat.No. : | RFL4678RF |
Product Overview : | Recombinant Full Length Rat Cell cycle control protein 50A(Tmem30a) Protein (Q6AY41) (2-328aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Rat |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length of Mature Protein (2-328) |
Form : | Lyophilized powder |
AA Sequence : | AMNYSAKDEVDGGPTGPPGGAAKTRRPDNTAFKQQRLPAWQPILTAGTVLPTFFIIGLIF IPIGIGIFVTSNNIREIEGNVFMYYGLSNFYQNHRRYVKSRDDSQLNGDPSALLNPSKEC EPYRRNEDKPIAPCGAIANSMFNDTLELFLVANESDPKPVPILLKKKGIAWWTDKNVKFR NPPGKDSLQEKFKDTTKPVNWHKPVYELDPDDESNNGFINEDFIVWMRTAALPTFRKLYR LIERTDDLHPTLPAGQYYLNITYNYPVHFFDGRKRMILSTISWMGGKNPFLGIAYITIGS ISFLLGVVLLVINHKYRNSSNTADITI |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | Tmem30a |
Synonyms | Tmem30a; Cdc50a; Cell cycle control protein 50A; P4-ATPase flippase complex beta subunit TMEM30A; Transmembrane protein 30A |
UniProt ID | Q6AY41 |
◆ Recombinant Proteins | ||
TMEM30A-9388M | Recombinant Mouse TMEM30A Protein, His (Fc)-Avi-tagged | +Inquiry |
RFL8353MF | Recombinant Full Length Mouse Cell Cycle Control Protein 50A(Tmem30A) Protein, His-Tagged | +Inquiry |
RFL7663GF | Recombinant Full Length Chicken Cell Cycle Control Protein 50A(Tmem30A) Protein, His-Tagged | +Inquiry |
TMEM30A-3823H | Recombinant Human TMEM30A Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
TMEM30A-2096C | Recombinant Chicken TMEM30A | +Inquiry |
◆ Cell & Tissue Lysates | ||
TMEM30A-688HCL | Recombinant Human TMEM30A lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Tmem30a Products
Required fields are marked with *
My Review for All Tmem30a Products
Required fields are marked with *