Recombinant Full Length Rat Corticotropin-Releasing Factor Receptor 1(Crhr1) Protein, His-Tagged
Cat.No. : | RFL12425RF |
Product Overview : | Recombinant Full Length Rat Corticotropin-releasing factor receptor 1(Crhr1) Protein (P35353) (24-415aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Rat |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length of Mature Protein (24-415) |
Form : | Lyophilized powder |
AA Sequence : | SLQDQRCENLSLTSNVSGLQCNASVDLIGTCWPRSPAGQLVVRPCPAFFYGVRYNTTNNG YRECLANGSWAARVNYSECQEILNEEKKSKVHYHVAVIINYLGHCISLVALLVAFVLFLR LRSIRCLRNIIHWNLISAFILRNATWFVVQLTVSPEVHQSNVAWCRLVTAAYNYFHVTNF FWMFGEGCYLHTAIVLTYSTDRLRKWMFVCIGWGVPFPIIVAWAIGKLHYDNEKCWFGKR PGVYTDYIYQGPMILVLLINFIFLFNIVRILMTKLRASTTSETIQYRKAVKATLVLLPLL GITYMLFFVNPGEDEVSRVVFIYFNSFLESFQGFFVSVFYCFLNSEVRSAIRKRWRRWQD KHSIRARVARAMSIPTSPTRVSFHSIKQSTAV |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | Crhr1 |
Synonyms | Crhr1; Crhr; Corticotropin-releasing factor receptor 1; CRF-R-1; CRF-R1; CRFR-1; Corticotropin-releasing hormone receptor 1; CRH-R-1; CRH-R1 |
UniProt ID | P35353 |
◆ Recombinant Proteins | ||
CRHR1-585HF | Recombinant Full Length Human CRHR1 Protein | +Inquiry |
CRHR1-1867H | Recombinant Human CRHR1 Protein, GST-tagged | +Inquiry |
CRHR1-1028R | Recombinant Rhesus monkey CRHR1 Protein, His-tagged | +Inquiry |
CRHR1-853R | Recombinant Rhesus Macaque CRHR1 Protein, His (Fc)-Avi-tagged | +Inquiry |
CRHR1-185H | Recombinant Human CRHR1 protein | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Crhr1 Products
Required fields are marked with *
My Review for All Crhr1 Products
Required fields are marked with *
0
Inquiry Basket