Recombinant Full Length Rat Cytochrome B5 Type B(Cyb5B) Protein, His-Tagged
| Cat.No. : | RFL22458RF | 
| Product Overview : | Recombinant Full Length Rat Cytochrome b5 type B(Cyb5b) Protein (P04166) (12-146aa), fused to N-terminal His tag, was expressed in E. coli. | 
- Specification
- Gene Information
- Related Products
- Download
| Species : | Rat | 
| Source : | E.coli | 
| Tag : | His | 
| Protein Length : | Full Length of Mature Protein (12-146) | 
| Form : | Lyophilized powder | 
| AA Sequence : | NGQGSDPAVTYYRLEEVAKRNTAEETWMVIHGRVYDITRFLSEHPGGEEVLLEQAGADATESFEDVGHSPDAREMLKQYYIGDVHPNDLKPKDGDKDPSKNNSCQSSWAYWIVPIVGAILIGFLYRHFWADSKSS | 
| Purity : | Greater than 90% as determined by SDS-PAGE. | 
| Applications : | SDS-PAGE | 
| Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. | 
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. | 
| Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 | 
| Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. | 
| Gene Name | Cyb5b | 
| Synonyms | Cyb5b; Cyb5m; Omb5; Cytochrome b5 type B; Cytochrome b5 outer mitochondrial membrane isoform | 
| UniProt ID | P04166 | 
| ◆ Recombinant Proteins | ||
| CYB5B-12135Z | Recombinant Zebrafish CYB5B | +Inquiry | 
| Cyb5b-2400M | Recombinant Mouse Cyb5b Protein, Myc/DDK-tagged | +Inquiry | 
| CYB5B-4656H | Recombinant Human CYB5B protein, His-tagged | +Inquiry | 
| CYB5B-4122M | Recombinant Mouse Cyb5b Protein, C-Myc/DDK tagged | +Inquiry | 
| CYB5B-1123R | Recombinant Rhesus monkey CYB5B Protein, His-tagged | +Inquiry | 
| ◆ Cell & Tissue Lysates | ||
| CYB5B-7145HCL | Recombinant Human CYB5B 293 Cell Lysate | +Inquiry | 
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (1)
Ask a Question for All Cyb5b Products
Required fields are marked with *
My Review for All Cyb5b Products
Required fields are marked with *
 
  
        
    
       
                         
                            