Recombinant Full Length Rat Fxyd Domain-Containing Ion Transport Regulator 3(Fxyd3) Protein, His-Tagged
Cat.No. : | RFL30667RF |
Product Overview : | Recombinant Full Length Rat FXYD domain-containing ion transport regulator 3(Fxyd3) Protein (P59645) (21-88aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Rat |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length (21-88) |
Form : | Lyophilized powder |
AA Sequence : | NDPEDKDSPFYYDWHSLRVGGLICAGILCALGIIVLMSGKCKCKFSQKPSHRPGDGPPLITPGSAHNC |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | Fxyd3 |
Synonyms | Fxyd3; FXYD domain-containing ion transport regulator 3; Sodium/potassium-transporting ATPase subunit FXYD3 |
UniProt ID | P59645 |
◆ Recombinant Proteins | ||
FXYD3-4429H | Recombinant Human FXYD3 protein, His-SUMO-tagged | +Inquiry |
FXYD3-5279HF | Recombinant Full Length Human FXYD3 Protein, GST-tagged | +Inquiry |
FXYD3-2078R | Recombinant Rat FXYD3 Protein, His (Fc)-Avi-tagged | +Inquiry |
RFL30667RF | Recombinant Full Length Rat Fxyd Domain-Containing Ion Transport Regulator 3(Fxyd3) Protein, His-Tagged | +Inquiry |
Fxyd3-3114M | Recombinant Mouse Fxyd3 Protein, Myc/DDK-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
FXYD3-6101HCL | Recombinant Human FXYD3 293 Cell Lysate | +Inquiry |
FXYD3-6100HCL | Recombinant Human FXYD3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Fxyd3 Products
Required fields are marked with *
My Review for All Fxyd3 Products
Required fields are marked with *