Recombinant Full Length Human FXYD3 Protein

Cat.No. : FXYD3-172HF
Product Overview : Recombinant full length Human FXDY3 with N terminal proprietary tag; Predicted MWt 33.48 kDa.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Protein Length : 67 amino acids
Description : This gene belongs to a small family of FXYD-domain containing regulators of Na+/K+ ATPases which share a 35-amino acid signature sequence domain, beginning with the sequence PFXYD, and containing 7 invariant and 6 highly conserved amino acids. This gene encodes a cell membrane protein that may regulate the function of ion-pumps and ion-channels. This gene may also play a role in tumor progression. Alternative splicing results in multiple transcript variants encoding distinct isoforms.
Form : Liquid
Molecular Mass : 33.480kDa inclusive of tags
AA Sequence : NDLEDKNSPFYYDWHSLQVGGLICAGVLCAMGIIIVMSAKCKCKFGQKSGHHPGETPPLITPGSAQS
Purity : Proprietary Purification
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80 centigrade. Avoid freeze / thaw cycles.
Storage Buffer : pH: 8.00. Constituents:0.79% Tris HCl, 0.31% Glutathione.
Gene Name FXYD3 FXYD domain containing ion transport regulator 3 [ Homo sapiens ]
Official Symbol FXYD3
Synonyms FXYD3; FXYD domain containing ion transport regulator 3; FXYD domain containing ion transport regulator 3 , PLML; FXYD domain-containing ion transport regulator 3; MAT 8
Gene ID 5349
mRNA Refseq NM_001136007
Protein Refseq NP_001129479
MIM 604996
UniProt ID Q14802

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All FXYD3 Products

Required fields are marked with *

My Review for All FXYD3 Products

Required fields are marked with *

0
cart-icon
0
compare icon