Recombinant Full Length Rat Glucagon Receptor(Gcgr) Protein, His-Tagged
Cat.No. : | RFL33811RF |
Product Overview : | Recombinant Full Length Rat Glucagon receptor(Gcgr) Protein (P30082) (27-485aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Rat |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length of Mature Protein (27-485) |
Form : | Lyophilized powder |
AA Sequence : | AQVMDFLFEKWKLYSDQCHHNLSLLPPPTELVCNRTFDKYSCWPDTPPNTTANISCPWYL PWYHKVQHRLVFKRCGPDGQWVRGPRGQSWRDASQCQMDDDEIEVQKGVAKMYSSYQVMY TVGYSLSLGALLLALVILLGLRKLHCTRNYIHGNLFASFVLKAGSVLVIDWLLKTRYSQK IGDDLSVSVWLSDGAVAGCRVATVIMQYGIIANYCWLLVEGVYLYSLLSITTFSEKSFFS LYLCIGWGSPLLFVIPWVVVKCLFENVQCWTSNDNMGFWWILRIPVLLAILINFFIFVRI IHLLVAKLRAHQMHYADYKFRLARSTLTLIPLLGVHEVVFAFVTDEHAQGTLRSTKLFFD LFFSSFQGLLVAVLYCFLNKEVQAELLRRWRRWQEGKALQEERMASSHGSHMAPAGTCHG DPCEKLQLMSAGSSSGTGCEPSAKTSLASSLPRLADSPT |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | Gcgr |
Synonyms | Gcgr; Glucagon receptor; GL-R |
UniProt ID | P30082 |
◆ Recombinant Proteins | ||
GCGR-1493H | Recombinant Human GCGR protein, hFc-tagged | +Inquiry |
GCGR-001H | Recombinant Human GCGR Protein, His-tagged | +Inquiry |
GCGR-2488R | Recombinant Rat GCGR Protein | +Inquiry |
GCGR-1571H | Recombinant Human GCGR Protein, His&GST-tagged | +Inquiry |
RFL6HF | Recombinant Full Length Human Glucagon Receptor(Gcgr) Protein, His-Tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
GCGR-5989HCL | Recombinant Human GCGR 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Gcgr Products
Required fields are marked with *
My Review for All Gcgr Products
Required fields are marked with *
0
Inquiry Basket